KpATCC43816 Protein target profile
helix-turn-helix domain, rpiR family protein
Accession: VK055_0079
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 28.139 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 92.28 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MNMLEKIQSRLEHLSKSERKVAEVILATPEQAIHSSIAALALEAGVSEPTVNRFCRSLETRGFPDFKLHLAQSLAHGTLYVNRNVDEDDSVESYTGKIFESAMASLDQVHHSLDMSAVNRAVDLLTQAKKIAFFGLGSSAAVAHDAMNKFFRFNVPVIYSDDIVLQRMSCMNCDDDDVVVIISHTGRTKSLVELAQLARENDAMVIALTSAGTPLAREATLAITLDVPEDTDIYMPMVSRLAQLTVIDVLATGFTLRRGAKFRDNLKRVKEALKESRFDKEPFVPSDNQ
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
5- GO:0097367 Binding to a carbohydrate derivative.
- GO:1901135 The chemical reactions and pathways involving carbohydrate derivative.
- GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 92 | 277 | Gene3D | G3DSA:3.40.50.10490 | - |
| 121 | 260 | ProSiteProfiles | PS51464 | SIS domain profile. |
| 121 | 260 | InterPro | IPR001347 | SIS domain |
| 1 | 78 | SUPERFAMILY | SSF46689 | Homeodomain-like |
| 1 | 78 | InterPro | IPR009057 | Homeobox-like domain superfamily |
| 124 | 252 | Pfam | PF01380 | SIS domain |
| 124 | 252 | InterPro | IPR001347 | SIS domain |
| 1 | 277 | PANTHER | PTHR30514 | GLUCOKINASE |
| 1 | 277 | InterPro | IPR047640 | HTH-type transcriptional regulator RpiR-like |
| 1 | 78 | Gene3D | G3DSA:1.10.10.10 | - |
| 1 | 78 | InterPro | IPR036388 | Winged helix-like DNA-binding domain superfamily |
| 1 | 77 | FunFam | G3DSA:1.10.10.10:FF:000060 | DNA-binding transcriptional regulator HexR |
| 1 | 76 | Pfam | PF01418 | Helix-turn-helix domain, rpiR family |
| 1 | 76 | InterPro | IPR000281 | Helix-turn-helix protein RpiR |
| 1 | 77 | ProSiteProfiles | PS51071 | RpiR-type HTH domain profile. |
| 1 | 77 | InterPro | IPR000281 | Helix-turn-helix protein RpiR |
| 116 | 253 | CDD | cd05013 | SIS_RpiR |
| 116 | 253 | InterPro | IPR035472 | RpiR-like, SIS domain |
| 94 | 277 | SUPERFAMILY | SSF53697 | SIS domain |
| 94 | 277 | InterPro | IPR046348 | SIS domain superfamily |
| 92 | 277 | FunFam | G3DSA:3.40.50.10490:FF:000009 | DNA-binding transcriptional regulator HexR |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GUT9
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_0079
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 4QY RCSB PDB | P77245 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@@H]1[C@H]([C@@H]([C@H](O[C@H]1O)COP(=…
|
|
| J79 RCSB PDB | P77245 | 373.3 Da LogP -2.46 TPSA 192.1 | 1 viol. | ✓ Clean |
C[C@H](C(=O)O)O[C@@H]1[C@H]([C@@H](O[C@@H]([C@H…
|
|
| MXE RCSB PDB | A0A0H2VHQ2 | 76.1 Da LogP -0.37 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
COCCO
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100350901 ZINC | 1.000 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@@H]1[C@H](O)O[C@H](COP(=O)(O)O)[C@H](…
|
| ZINC1530414 ZINC | 1.000 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@@H]1[C@@H](O)O[C@@H](COP(=O)(O)O)[C@H…
|
| ZINC1532625 ZINC | 1.000 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)[C@@H](O)[C@H](COP(=O)(O)O…
|
| ZINC245204467 ZINC | 1.000 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)[C@@H](O)[C@@H](COP(=O)(O)…
|
| ZINC245204468 ZINC | 1.000 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)[C@H](O)[C@@H](COP(=O)(O)O…
|
| ZINC30725207 ZINC | 1.000 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@@H]1[C@H](O)O[C@H](COP(=O)(O)O)[C@@H]…
|
| ZINC4096363 ZINC | 1.000 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@@H]1[C@@H](O)O[C@H](COP(=O)(O)O)[C@@H…
|
| ZINC4097100 ZINC | 1.000 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@H](COP(=O)(O)O)[C@@H]…
|
| ZINC4097101 ZINC | 1.000 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3861769 ZINC | 0.708 | 293.3 Da LogP -2.58 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]…
|
| ZINC4096938 ZINC | 0.708 | 293.3 Da LogP -2.58 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]…
|
| ZINC4245657 ZINC | 0.708 | 293.3 Da LogP -2.58 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@@H](CO)[C@@H](O)[C@@H…
|
| ZINC44608202 ZINC | 0.708 | 293.3 Da LogP -2.58 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@H](O)[C@@H]1…
|
| ZINC62227779 ZINC | 0.708 | 293.3 Da LogP -2.58 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@H](O[C@@H](C)C(=O)O)[C@@H](O)[C…
|
| ZINC71755829 ZINC | 0.708 | 293.3 Da LogP -2.58 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H…
|
| ZINC71755842 ZINC | 0.708 | 293.3 Da LogP -2.58 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H]1[C@@H](O)O[C@@H](CO)[C@@H](O)[C@@…
|
| ZINC79670001 ZINC | 0.708 | 293.3 Da LogP -2.58 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@@H](CO)[C@@H](O)[C@@H…
|
| ZINC8585107 ZINC | 0.708 | 293.3 Da LogP -2.58 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H]1[C@H](O)O[C@H](CO)[C@H](O)[C@@H]1…
|
| ZINC8585110 ZINC | 0.708 | 293.3 Da LogP -2.58 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H]1[C@H](O)O[C@H](CO)[C@H](O)[C@@H]1…
|
| ZINC8602542 ZINC | 0.708 | 293.3 Da LogP -2.58 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@H](O[C@H](C)C(=O)O)[C@@H](O)[C@…
|
| ZINC1580161 ZINC | 0.647 | 208.3 Da LogP -0.33 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCO
|
| ZINC16052118 ZINC | 0.647 | 340.4 Da LogP -0.28 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCO
|
| ZINC16052257 ZINC | 0.647 | 384.5 Da LogP -0.26 TPSA 94.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC34317654 ZINC | 0.647 | 472.6 Da LogP -0.23 TPSA 112.5 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC44076059 ZINC | 0.647 | 428.5 Da LogP -0.24 TPSA 103.3 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5210101 ZINC | 0.647 | 252.3 Da LogP -0.31 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCO
|
| ZINC5997860 ZINC | 0.647 | 296.4 Da LogP -0.29 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCO
|
| ZINC13543977 ZINC | 0.628 | 301.3 Da LogP -3.25 TPSA 162.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@H](COS(=O)(=O)O)[C@H]…
|
| ZINC13543979 ZINC | 0.628 | 301.3 Da LogP -3.25 TPSA 162.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@H](COS(=O)(=O)O)[C@@H…
|
| ZINC4096329 ZINC | 0.628 | 301.3 Da LogP -3.25 TPSA 162.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)O[C@H](COS(=O)(=O)O)[C@@H]…
|
| ZINC4096360 ZINC | 0.628 | 301.3 Da LogP -3.25 TPSA 162.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)O[C@H](COS(=O)(=O)O)[C@H](…
|
| ZINC12504154 ZINC | 0.622 | 230.1 Da LogP -2.47 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O)[C@@H](O)[C@@H]1O
|
| ZINC1532546 ZINC | 0.622 | 230.1 Da LogP -2.47 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@H](O)[C@@H](O)[C@H]1O
|
| ZINC4096190 ZINC | 0.622 | 230.1 Da LogP -2.47 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O)[C@H](O)[C@@H]1O
|
| ZINC4228241 ZINC | 0.622 | 230.1 Da LogP -2.47 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@@H](O)[C@H](O)[C@@H]1O
|
| ZINC4521831 ZINC | 0.622 | 230.1 Da LogP -2.47 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@@H](O)[C@@H](O)[C@@H]1O
|
| ZINC1042045 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H]1[C@H](O)[C@H](O)[C@H](CO)O[C@H]1O
|
| ZINC16124914 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H]1[C@H](O)O[C@H](CO)[C@H](O)[C@@H]1O
|
| ZINC2562219 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@H](O)[C@@H]1O
|
| ZINC3860151 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]…
|
| ZINC3870075 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@@H](CO)[C@@H](O)[C@H]…
|
| ZINC3983907 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O
|
| ZINC4228290 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]…
|
| ZINC4293686 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O
|
| ZINC4301186 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H]1[C@@H](O)O[C@H](CO)[C@H](O)[C@@H]…
|
| ZINC5227360 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O[C@H]1O
|
| ZINC5883957 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H]1[C@H](O)[C@H](O)[C@@H](CO)O[C@H]1O
|
| ZINC5883978 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)O[C@@H](CO)[C@H](O)[C@@H]1O
|
| ZINC895332 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@@H](CO)[C@H](O)[C@H]1O
|
| ZINC901459 ZINC | 0.615 | 221.2 Da LogP -3.08 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H]1[C@H](O)[C@@H](O)[C@@H](CO)O[C@H]…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.