KpATCC43816 Protein target profile

putative glutathione peroxidase

Accession: VK055_0289

Gene: AIK78915.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A0H3GRA3
Length 183
Pocket druggability (P2Rank · AlphaFold DB model) 0.132
Metabolic reactions 1
Chokepoint No
Direct ligand evidence 0 106 total records
Functional annotation 2 EC 4 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
56.522 Lower values reduce human off-target concern.
Human E-value
3.37e-17
Gut microbiome similarity
2.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
75.956 Higher values support similarity to known essential genes.
DEG E-value
1.61e-101 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
96.54 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.132
Structure A0A0H3GRA3
Pocket Pocket 1
Druggability (FPocket) 0.284
Structure A0A0H3GRA3
Pocket Pocket 12
ColabFold model
P2Rank 0.211 · Pocket 1
FPocket 0.503 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 132 / 4744 genomes with a hit
Prevalence 2.8%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network
Relative network centrality 0.0% more central than 0.0% of genes in this genome
Chokepoint Not a chokepoint
Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MQHDILNTEVTTIDGEKTTLASFAGKVLLIVNVASKCGLTPQYEQLEDLQKQFAAEGFSVLGFPCNQFLGQEPGSEEEIKTFCSTTYGVTFPLFSKIDVNGEHRAPLYQKLIAAAPKAVAPEGSGFYERMASKGRAPLYVDDILWNFEKFLIDRQGNVIQRFSPDMTPDDPQLVAAIKGALAQ

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 EC 4 GO

Subcellular localization

Localization
Periplasmic

Enzyme Commission (EC)

2

Gene Ontology (GO)

4
  • GO:0006979 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
  • GO:0004602 Catalysis of the reaction: 2 glutathione + H2O2 = oxidized glutathione + 2 H2O.
  • GO:0140824 Catalysis of the reaction: [thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.
  • GO:0034599 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

25 records
Show feature table
Start End DB Term Name
6 111 Pfam PF00255 Glutathione peroxidase
6 111 InterPro IPR000889 Glutathione peroxidase
25 40 ProSitePatterns PS00460 Glutathione peroxidases active site.
25 40 InterPro IPR029759 Glutathione peroxidase active site
1 183 ProSiteProfiles PS51355 Glutathione peroxidase profile.
1 183 InterPro IPR000889 Glutathione peroxidase
1 183 PIRSF PIRSF000303 Glutathion_perox
4 170 PANTHER PTHR11592 GLUTATHIONE PEROXIDASE
4 170 InterPro IPR000889 Glutathione peroxidase
5 182 SUPERFAMILY SSF52833 Thioredoxin-like
5 182 InterPro IPR036249 Thioredoxin-like superfamily
4 177 CDD cd00340 GSH_Peroxidase
4 177 InterPro IPR000889 Glutathione peroxidase
1 183 FunFam G3DSA:3.40.30.10:FF:000010 Glutathione peroxidase
3 183 Hamap MF_02061 Thioredoxin/glutathione peroxidase BtuE [btuE].
3 183 InterPro IPR033674 Thioredoxin/glutathione peroxidase BtuE
1 183 Gene3D G3DSA:3.40.30.10 Glutaredoxin
61 68 ProSitePatterns PS00763 Glutathione peroxidases signature 2.
61 68 InterPro IPR029760 Glutathione peroxidase conserved site
23 40 PRINTS PR01011 Glutathione peroxidase family signature
23 40 InterPro IPR000889 Glutathione peroxidase
58 74 PRINTS PR01011 Glutathione peroxidase family signature
58 74 InterPro IPR000889 Glutathione peroxidase
143 152 PRINTS PR01011 Glutathione peroxidase family signature
143 152 InterPro IPR000889 Glutathione peroxidase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.132
Likely same site as FPocket 12 3.7 Å 12 shared residues 92% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.073
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.014
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.005
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #12
0.284
Likely same site as P2Rank 1 3.7 Å 12 shared residues 92% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #1
0.223
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:37-37
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GRA3
AlphaFold DB full sequence Viewing
ColabFold VK055_0289
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

106 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 56 records from similar proteins
Structural ligands 3 0 loaded crystals
Measured bioactivity 53 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
G9N PDB via homolog 477.4 Da · LogP 5.08 · TPSA 58.6 Open detail RCSB PDB
NH4 PDB via homolog Detail RCSB PDB
POP PDB via homolog Detail RCSB PDB
CHEMBL1499544 ChEMBL via homolog · pchembl 7.55 (~28.2 nM) Detail ChEMBL
CHEMBL5618406 ChEMBL via homolog · pchembl 7.44 (~36.3 nM) Detail ChEMBL

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
G9N RCSB PDB P36969 477.4 Da LogP 5.08 TPSA 58.6 1 viol. ✓ Clean COc1ccc(cc1Cl)N([C@H](c2cccs2)C(=O)NCCc3ccccc3)…
NH4 RCSB PDB Q8T8E2 18.0 Da LogP 0.38 TPSA 36.5 ✓ Ro5 ✓ Clean [NH4+]
POP RCSB PDB Q00277 176.0 Da LogP -2.08 TPSA 129.9 ✓ Ro5 ✓ Clean O[P@@](=O)([O-])O[P@@](=O)(O)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.