KpATCC43816 Protein target profile

sugar (and other) transporter family protein

Accession: VK055_0345

Gene: AIK78971.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GUS7
Length 386
Pocket druggability (P2Rank · AlphaFold DB model) 0.792
Functional annotation 0 EC 5 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
35.714 Lower values reduce human off-target concern.
Human E-value
9.63e-08
Gut microbiome similarity
0.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
52.174 Higher values support similarity to known essential genes.
DEG E-value
1.81e-83 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
89.85 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.792
Structure A0A0H3GUS7
Pocket Pocket 1
Druggability (FPocket) 0.896
Structure A0A0H3GUS7
Pocket Pocket 19
ColabFold model
P2Rank 0.738 · Pocket 1
FPocket 0.84 · Pocket 21
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 23 / 4744 genomes with a hit
Prevalence 0.5%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MVTIGLCFMVALMEGLDLQAAGIAAVGMAQAFALDKMQMGWIFSAGILGLLPGALVGGMLADRHGRKRILLGSVLLFGLFSLATALAWSFPTLLLARLLTGVGLGAALPNLIALTSEAAGSRFRGRAVSLMYCGVPIGAALAAALGFSGLAVAWQTIFWIGGVVPLLLIPLLMRWLPESQAFQRAEASVPLRTLFAPGHAAATLLLWLGYFFTLLVVYMLINWLPMLLVGQGFRASQAAGVMFSLQIGAACGTLLLGALMDKLTPLRMSLLIYSGILASLLALGSASSLNGMLLAGFVAGLFATGGQSVLYALAPLFYPAAIRATGVGTAVAVGRLGAMSGPLLAGKMLALGTGTVGVMAASAPGIVLAGVAVFWLMHRQQRAAIV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

5
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0046943 Enables the transfer of carboxylic acids from one side of a membrane to the other. Carboxylic acids are organic acids containing one or more carboxyl (COOH) groups or anions (COO-).

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

54 records
Show feature table
Start End DB Term Name
354 376 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
128 150 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
116 126 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
148 152 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
269 286 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
241 258 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
99 124 ProSitePatterns PS00217 Sugar transport proteins signature 2.
99 124 InterPro IPR005829 Sugar transporter, conserved site
3 383 PANTHER PTHR23508 CARBOXYLIC ACID TRANSPORTER PROTEIN HOMOLOG
378 386 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
1 15 SignalP_EUK SignalP-TM SignalP-TM
293 313 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
4 380 CDD cd17365 MFS_PcaK_like
259 269 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
320 338 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
154 176 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
127 147 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
174 193 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
41 61 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
199 384 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
199 384 InterPro IPR036259 MFS transporter superfamily
7 29 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 31 Phobius SIGNAL_PEPTIDE Signal peptide region
39 61 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
32 40 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
68 88 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
270 287 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
288 292 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
3 381 ProSiteProfiles PS50850 Major facilitator superfamily (MFS) profile.
3 381 InterPro IPR020846 Major facilitator superfamily domain
339 357 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
94 115 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
153 173 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
222 240 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
201 223 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
320 339 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 188 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
1 188 InterPro IPR036259 MFS transporter superfamily
68 90 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
8 284 Pfam PF07690 Major Facilitator Superfamily
8 284 InterPro IPR011701 Major facilitator superfamily
314 319 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
358 377 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
94 116 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
291 313 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
194 221 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
62 67 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
2 13 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 1 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
14 31 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
3 382 SUPERFAMILY SSF103473 MFS general substrate transporter
3 382 InterPro IPR036259 MFS transporter superfamily
238 260 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
89 93 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.792
Likely same site as FPocket 19 5.4 Å 21 shared residues 78% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.209
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.203
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.007
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.006
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #19
0.896 Unusual size
Likely same site as P2Rank 1 5.4 Å 21 shared residues 78% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GUS7
AlphaFold DB full sequence Viewing
ColabFold VK055_0345
ColabFold full sequence Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.