KpATCC43816 Protein target profile

fecCD transport family protein

Accession: VK055_0360

Gene: AIK78986.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GU15
Length 350
Pocket druggability (P2Rank · AlphaFold DB model) 0.57
Direct ligand evidence 0 52 total records
Functional annotation 0 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
37.107 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
90.73 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.57
Structure A0A0H3GU15
Pocket Pocket 1
Druggability (FPocket) 0.823
Structure A0A0H3GU15
Pocket Pocket 1
ColabFold model
P2Rank 0.46 · Pocket 1
FPocket 0.642 · Pocket 1
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 34 / 4744 genomes with a hit
Prevalence 0.7%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MTRAVHRAGFRPLVIASRQLLLRPAALNIAAIMMLMLLALGLYSLSRGSFPLPASTLARALLAPQEMGEQPRFILFDIRLPRILMALLCGAMLGLAGAAMQSITRNGLADPGLIGVKEGANIVVLALVLFFPAVGLVWRPLAGMVGGVAVALLVLTLARDCSRPRFILIGIGVSWTLAAAVGIFMTTADVRDVQTAMIWLAGSLQAATWPLLAVAFCWALPGAIILFCTARAADVALLGDRTAIGLGVRLQQLTMLRFFAPVLLTSASVSCVGSLGFVGLMAPHMARFVLRGGQVSLLCGSALIGALLVLVTDTLGRLAFAPLQIPAGIVIALVGCPFFVVLLWRRRDAL

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

4
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0033214 A process in which iron (Fe3+) is solubilized by ferric iron-specific chelators, known as siderophores is imported into the cell by transmembrane transport or endocytosis.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

38 records
Show feature table
Start End DB Term Name
20 43 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
132 136 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
24 346 SUPERFAMILY SSF81345 ABC transporter involved in vitamin B12 uptake, BtuC
24 346 InterPro IPR037294 ABC transporter, BtuC-like
207 228 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
208 230 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
140 159 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
112 131 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
288 311 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
319 341 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
258 282 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
24 349 FunFam G3DSA:1.10.3470.10:FF:000001 Vitamin B12 ABC transporter permease BtuC
283 287 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
290 312 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
137 158 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
101 111 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
312 322 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
83 100 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
258 280 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
83 343 CDD cd06550 TM_ABC_iron-siderophores_like
323 344 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 19 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
20 42 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
165 187 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
113 135 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
29 348 PANTHER PTHR30472 FERRIC ENTEROBACTIN TRANSPORT SYSTEM PERMEASE PROTEIN
29 348 InterPro IPR000522 ABC transporter, permease protein, BtuC-like
37 345 Pfam PF01032 FecCD transport family
37 345 InterPro IPR000522 ABC transporter, permease protein, BtuC-like
25 349 Gene3D G3DSA:1.10.3470.10 ABC transporter involved in vitamin B12 uptake, BtuC
25 349 InterPro IPR037294 ABC transporter, BtuC-like
44 82 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
166 188 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
159 164 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
188 206 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
78 100 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
345 350 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
229 257 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.57
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.224
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.146
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.138
Likely same site as FPocket 8 2.5 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.075
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.823
Show in viewer
Surrounding area
Pocket 2 FPocket #31
0.627
Show in viewer
Surrounding area
Pocket 3 FPocket #29
0.456
Show in viewer
Surrounding area
Pocket 4 FPocket #8
0.4
Likely same site as P2Rank 4 2.5 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GU15
AlphaFold DB full sequence Viewing
ColabFold VK055_0360
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
ANP PDB via homolog 506.2 Da · LogP -2.06 · TPSA 281.9 Open detail RCSB PDB
LDA PDB via homolog Detail RCSB PDB
ZINC1849937 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC2008702 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC2039372 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ANP RCSB PDB P06609 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
LDA RCSB PDB P06609 229.4 Da LogP 4.48 TPSA 23.1 ✓ Ro5 ✓ Clean CCCCCCCCCCCC[N+](C)(C)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.