KpATCC43816 Protein target profile

ccmC

Accession: VK055_0395

Gene: AIK79021.1 ccmC 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GUP4
Export view
Length 245
Pocket druggability (P2Rank · AlphaFold DB model) 0.926
Functional annotation 0 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Independent pocket support: P2Rank + FPocket Both predictors report a high-scoring binding site (P2Rank 0.93, FPocket 0.88). Use the 3D pocket comparison to verify whether they identify the same site. No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Strong predicted binding pocket FPocket selected-pocket score 0.88. This is a computational pocket signal, not binding validation. Review the complete evidence below

Risks to review

Microbiome similarity 114 of 4744 screened genomes (2.4%) have a significant similarity hit. This target also has a predicted binding pocket (P2Rank 0.93) — check the ligand evidence before deprioritizing on off-target risk alone.

Evidence gaps

No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
49.115 Higher values support similarity to known essential genes.
DEG E-value
1.58e-56 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
92.01 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.926
Structure A0A0H3GUP4
Pocket Pocket 1
Druggability (FPocket) 0.877
Structure A0A0H3GUP4
Pocket Pocket 21
ColabFold model
P2Rank 0.947 · Pocket 1
FPocket 0.84 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 114 / 4744 genomes with a hit
Prevalence 2.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MWKALHQLAIPERLYRLCGCWIPWLAALSALLLVIGLGWGFGFAPADYQQGESYRIMYLHVPAAMWSMGLYLAMAVAAFVGVVWQIKMADLAIAALAPVGAVCTLVALVSGAAWGKPMWGTWWIWDARLTSELVLLFLYAGVIALWHAFDDRRLAGRAAGILVLVGVVNLPIIHYSVYWWNTLHQGSTNLQQTIDPSMRLPLRICIFAFLTLSVTLTLMRLRNLILQLERHRPWVVALVNKGAAR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

6
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0017004 The aggregation, arrangement and bonding together of a cytochrome complex. A cytochrome complex is a protein complex in which at least one of the proteins is a cytochrome, i.e. a heme-containing protein involved in catalysis of redox reactions.
  • GO:0015232 Enables the transfer of heme from one side of a membrane to the other.
  • GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring.
  • GO:0015886 The directed movement of heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

37 records
Show feature table
Start End DB Term Name
114 132 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
222 245 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
92 114 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
124 146 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
27 212 PANTHER PTHR30071 HEME EXPORTER PROTEIN C
27 212 InterPro IPR045062 Cytochrome c-type biogenesis protein CcsA/CcmC
63 84 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
150 160 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
200 222 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
181 199 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
21 43 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
161 180 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
45 225 NCBIfam TIGR01191 heme ABC transporter permease CcmC
45 225 InterPro IPR003557 Cytochrome c-type biogenesis protein CcmC
21 43 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
158 180 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
200 221 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 20 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
201 225 PRINTS PR01386 Cytochrome c-type biogenesis protein CcmC signature
201 225 InterPro IPR003557 Cytochrome c-type biogenesis protein CcmC
45 62 PRINTS PR01386 Cytochrome c-type biogenesis protein CcmC signature
45 62 InterPro IPR003557 Cytochrome c-type biogenesis protein CcmC
62 82 PRINTS PR01386 Cytochrome c-type biogenesis protein CcmC signature
62 82 InterPro IPR003557 Cytochrome c-type biogenesis protein CcmC
100 120 PRINTS PR01386 Cytochrome c-type biogenesis protein CcmC signature
100 120 InterPro IPR003557 Cytochrome c-type biogenesis protein CcmC
121 141 PRINTS PR01386 Cytochrome c-type biogenesis protein CcmC signature
121 141 InterPro IPR003557 Cytochrome c-type biogenesis protein CcmC
156 182 PRINTS PR01386 Cytochrome c-type biogenesis protein CcmC signature
156 182 InterPro IPR003557 Cytochrome c-type biogenesis protein CcmC
29 184 Pfam PF01578 Cytochrome C assembly protein
29 184 InterPro IPR002541 Cytochrome c assembly protein
133 149 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
85 90 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
91 113 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
63 85 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
44 62 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.926
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.462
Likely same site as FPocket 22 2.8 Å 13 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.166
Likely same site as FPocket 21 3.1 Å 9 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.096
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.016
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #21
0.877
Likely same site as P2Rank 3 3.1 Å 9 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #22
0.669
Likely same site as P2Rank 2 2.8 Å 13 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 FPocket #18
0.412
Show in viewer
Surrounding area
Pocket 4 FPocket #3
0.208
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GUP4
AlphaFold DB — — full sequence — Viewing
ColabFold VK055_0395
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GUP4