KpATCC43816 Protein target profile

major Facilitator Superfamily protein

Accession: VK055_0520

Gene: AIK79143.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GYV1
Length 384
Pocket druggability (P2Rank · AlphaFold DB model) 0.972
Functional annotation 0 EC 2 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
22.039 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
91.07 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.972
Structure A0A0H3GYV1
Pocket Pocket 1
Druggability (FPocket) 0.809
Structure A0A0H3GYV1
Pocket Pocket 4
ColabFold model
P2Rank 0.977 · Pocket 1
FPocket 0.95 · Pocket 20
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 26 / 4744 genomes with a hit
Prevalence 0.5%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MLTTGITALFSLTCALAVANVYSAQPLLDSMAVSLKVSPGMIGSVITTTQAGYAIGLLFLVPLGDWLNRKYVVMSQLLLSVAALVAAGLSPNIATLLGAMLIVGLMAVVVQVLVAWVAILATPQKRGQAVGTLTSGIVSGILLSRFISGAIADIAGWRAVYLTAACLMLVIAGVVWKIMPSPPQQPQPQKPTYLSLLKYVFQLYLTEPQLRKRGILALFIFAAFSMLWTTMVMPLTALSLSHTQTGMFGLAGFAGMLAAARAGKWADQGWAQRTTGLALALLTISWLPIGYAETSLLWLIAGVIALDFAVQAVHVSSQSLIIAARPAAASRLVGAYMCFYSLGSATGAIVATQLYSHWGWQAVCLAGATVSACAFLIWSGSRQS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

2
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

50 records
Show feature table
Start End DB Term Name
129 147 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
314 332 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
353 357 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
180 214 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
2 12 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
148 158 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 17 Phobius SIGNAL_PEPTIDE Signal peptide region
5 27 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
215 240 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
98 120 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
154 176 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
159 179 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 17 SignalP_EUK SignalP-TM SignalP-TM
9 378 CDD cd17324 MFS_NepI_like
42 64 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 384 ProSiteProfiles PS50850 Major facilitator superfamily (MFS) profile.
1 384 InterPro IPR020846 Major facilitator superfamily domain
264 269 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
127 149 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
246 263 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
379 384 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
333 352 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
71 93 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
3 379 PANTHER PTHR42910 TRANSPORTER SCO4007-RELATED
6 378 SUPERFAMILY SSF103473 MFS general substrate transporter
6 378 InterPro IPR036259 MFS transporter superfamily
358 378 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
71 90 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
296 315 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
123 128 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
332 354 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
91 95 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
290 294 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
96 122 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
18 40 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
275 292 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
14 321 Pfam PF07690 Major Facilitator Superfamily
14 321 InterPro IPR011701 Major facilitator superfamily
270 289 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 1 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
241 245 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
65 70 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
4 379 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
4 379 InterPro IPR036259 MFS transporter superfamily
295 313 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
358 380 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
13 17 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
214 236 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
41 64 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
246 263 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.972
Likely same site as FPocket 8 1.5 Å 32 shared residues 97% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.321
Likely same site as FPocket 4 1.2 Å 16 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.237
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.071
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.05
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #4
0.809
Likely same site as P2Rank 2 1.2 Å 16 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #8
0.78 Unusual size
Likely same site as P2Rank 1 1.5 Å 32 shared residues 97% of smaller site
Show in viewer
Surrounding area
Pocket 3 FPocket #3
0.315
Show in viewer
Surrounding area
Pocket 4 FPocket #9
0.228
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GYV1
AlphaFold DB full sequence Viewing
ColabFold VK055_0520
ColabFold full sequence Loaded