Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 31.461 Lower values reduce human off-target concern.
- Human E-value
- 2.67e-07
- Gut microbiome similarity
- 0.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 88.81 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTTLSEPLVTPKYGKWRQLVLGLICMAAISSPQYVWTLLTKPLAAKLGVGLPELQVTFSLLIILQTFFSPFQGRLVEKFGPRRLIAIGTVMAGMSWVLSAQVNGLATLWLVYGCMGGLGTGIVYIGVVGLMVKWFPQQRGFAAGAVAAGYGMGAIITTFPISLSLTTNGLEHTMTTFGILFALVGFLASQGLKLPPPAVSQPVSQTVVQSSRSFTSREMLRQPLFWLMFAMMAMMSTSGLMVTSQMAVFAEDFGISQAVVFGMAALPLALTIDRFTNGLTRPLFGFISDRFGREQTMFIAFALEGVAMMLWLACREDPLLFVLLSGVVFFGWGEIFSLFPSTLTDTFGSEHAASNYGWLYISQGIGSIFGGPLAALLYQHTHGWHVVFSCAIGLDFVTAALALWVLKPWRARFIRQHS
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Gene Ontology (GO)
5- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
- GO:0019532 The directed movement of oxalate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Oxalate, or ethanedioic acid, occurs in many plants and is highly toxic to animals.
- GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
- GO:0019531 Enables the transfer of oxalate from one side of a membrane to the other. Oxalate, or ethanedioic acid, occurs in many plants and is highly toxic to animals.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 35 | 267 | Pfam | PF07690 | Major Facilitator Superfamily |
| 35 | 267 | InterPro | IPR011701 | Major facilitator superfamily |
| 276 | 295 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 15 | 405 | CDD | cd17353 | MFS_OFA_like |
| 164 | 168 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 37 | 55 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 410 | ProSiteProfiles | PS50850 | Major facilitator superfamily (MFS) profile. |
| 1 | 410 | InterPro | IPR020846 | Major facilitator superfamily domain |
| 11 | 201 | Gene3D | G3DSA:1.20.1250.20 | MFS general substrate transporter like domains |
| 11 | 201 | InterPro | IPR036259 | MFS transporter superfamily |
| 216 | 412 | Gene3D | G3DSA:1.20.1250.20 | MFS general substrate transporter like domains |
| 216 | 412 | InterPro | IPR036259 | MFS transporter superfamily |
| 141 | 163 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 20 | 39 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 224 | 243 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 56 | 72 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 103 | 107 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 244 | 254 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 18 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 106 | 128 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 379 | 383 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 384 | 406 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 15 | 417 | NCBIfam | TIGR04259 | oxalate/formate MFS antiporter |
| 15 | 417 | InterPro | IPR026355 | Oxalate/formate antiporter |
| 84 | 102 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 319 | 339 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 340 | 358 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 255 | 275 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 19 | 36 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 224 | 243 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 15 | 414 | SUPERFAMILY | SSF103473 | MFS general substrate transporter |
| 15 | 414 | InterPro | IPR036259 | MFS transporter superfamily |
| 359 | 378 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 108 | 132 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 384 | 406 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 14 | 388 | PANTHER | PTHR11360 | MONOCARBOXYLATE TRANSPORTER |
| 296 | 313 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 407 | 418 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 314 | 318 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 141 | 163 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 189 | 223 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 169 | 188 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 355 | 377 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 133 | 140 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 173 | 192 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 54 | 71 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 84 | 102 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 253 | 272 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 73 | 83 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 318 | 340 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GNI8
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_0744
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 02Q RCSB PDB | A0LNN5 | 164.2 Da LogP 2.01 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
Cc1ccccc1CCC(=O)O
|
|
| 1HN RCSB PDB | A0LNN5 | 188.2 Da LogP 2.24 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
c1ccc2c(c1)ccc(c2O)C(=O)O
|
|
| FIV RCSB PDB | A0LNN5 | 172.2 Da LogP 2.54 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
c1ccc2cc(ccc2c1)C(=O)O
|
|
| HCI RCSB PDB | A0LNN5 | 150.2 Da LogP 1.70 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)CCC(=O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC164010 ZINC | 0.870 | 222.2 Da LogP 3.69 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc2cc3ccccc3cc2c1
|
| ZINC156288 ZINC | 0.810 | 216.2 Da LogP 2.24 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc2cc(C(=O)O)ccc2c1
|
| ZINC406914 ZINC | 0.800 | 222.2 Da LogP 1.72 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCc1ccc(CCC(=O)O)cc1
|
| ZINC2528279 ZINC | 0.773 | 216.2 Da LogP 2.24 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc2ccc(C(=O)O)cc2c1
|
| ZINC406170 ZINC | 0.767 | 292.3 Da LogP 3.47 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccccc1C(=O)c1ccc2ccccc2c1O
|
| ZINC9998612 ZINC | 0.750 | 226.3 Da LogP 3.37 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)CCc1ccc(-c2ccccc2)cc1
|
| ZINC2163727 ZINC | 0.739 | 222.2 Da LogP 1.72 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCc1cccc(CCC(=O)O)c1
|
| ZINC2599161 ZINC | 0.739 | 266.3 Da LogP 3.39 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc2cc3cc(C(=O)O)ccc3cc2c1
|
| ZINC1673354 ZINC | 0.727 | 238.3 Da LogP 3.82 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=C(CCc1ccccc1)CCc1ccccc1
|
| ZINC1693912 ZINC | 0.727 | 266.3 Da LogP 3.39 TPSA 34.1 | ✓ Ro5 | Alert |
O=C(CCc1ccccc1)C(=O)CCc1ccccc1
|
| ZINC3844983 ZINC | 0.720 | 260.3 Da LogP 3.91 TPSA 34.1 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccc2ccccc2c1)c1ccccc1
|
| ZINC2529014 ZINC | 0.704 | 248.3 Da LogP 4.21 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc3ccccc3c2)cc1
|
| ZINC39428991 ZINC | 0.704 | 222.2 Da LogP 3.69 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc2c(ccc3ccccc32)c1
|
| ZINC44672411 ZINC | 0.704 | 248.3 Da LogP 4.21 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc2cc(-c3ccccc3)ccc2c1
|
| ZINC2516358 ZINC | 0.700 | 224.3 Da LogP 3.81 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
Cc1ccccc1CCC(=O)c1ccccc1
|
| ZINC1680758 ZINC | 0.692 | 232.3 Da LogP 4.07 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=C(c1ccccc1)c1ccc2ccccc2c1
|
| ZINC247409588 ZINC | 0.692 | 220.3 Da LogP 2.44 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCC(=O)CCc1ccccc1
|
| ZINC29563531 ZINC | 0.692 | 200.2 Da LogP 2.11 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
O=C(O)C(=O)c1ccc2ccccc2c1
|
| ZINC1558609 ZINC | 0.680 | 248.4 Da LogP 4.43 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCc1ccccc1
|
| ZINC2510086 ZINC | 0.680 | 262.4 Da LogP 4.82 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCc1ccccc1
|
| ZINC2575483 ZINC | 0.680 | 206.3 Da LogP 3.26 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCc1ccccc1
|
| ZINC2575484 ZINC | 0.680 | 220.3 Da LogP 3.65 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCc1ccccc1
|
| ZINC2575485 ZINC | 0.680 | 234.3 Da LogP 4.04 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCc1ccccc1
|
| ZINC71256874 ZINC | 0.679 | 248.3 Da LogP 4.21 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc2ccc(-c3ccccc3)cc2c1
|
| ZINC84551502 ZINC | 0.677 | 243.1 Da LogP 2.77 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
Cc1cccc(CCC(=O)O)c1Br
|
| ZINC11962728 ZINC | 0.667 | 242.3 Da LogP 3.50 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCc1ccc(Oc2ccccc2)cc1
|
| ZINC1727327 ZINC | 0.667 | 208.2 Da LogP 1.33 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCc1ccccc1CC(=O)O
|
| ZINC19436641 ZINC | 0.667 | 203.2 Da LogP 1.66 TPSA 69.6 | ✓ Ro5 | ✓ Clean |
O=C(NO)c1ccc2ccccc2c1O
|
| ZINC345518 ZINC | 0.667 | 222.2 Da LogP 3.69 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc2ccc3ccccc3c2c1
|
| ZINC49820418 ZINC | 0.667 | 226.3 Da LogP 3.37 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)CCc1cccc(-c2ccccc2)c1
|
| ZINC100476725 ZINC | 0.656 | 290.3 Da LogP 4.00 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
O=C(CC(=O)c1ccc2ccccc2c1O)c1ccccc1
|
| ZINC71392 ZINC | 0.656 | 263.3 Da LogP 3.80 TPSA 49.3 | ✓ Ro5 | ✓ Clean |
O=C(Nc1ccccc1)c1ccc2ccccc2c1O
|
| ZINC1512447 ZINC | 0.655 | 276.3 Da LogP 3.77 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccccc1C(=O)c1ccc2ccccc2c1
|
| ZINC156804 ZINC | 0.655 | 251.1 Da LogP 3.30 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc2ccccc2c1Br
|
| ZINC1571200 ZINC | 0.655 | 216.2 Da LogP 2.24 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc2ccccc2c1C(=O)O
|
| ZINC163985 ZINC | 0.655 | 256.3 Da LogP 3.28 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCc1ccc(OCc2ccccc2)cc1
|
| ZINC2529015 ZINC | 0.655 | 248.3 Da LogP 4.21 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(-c2ccc3ccccc3c2)c1
|
| ZINC144318170 ZINC | 0.654 | 214.2 Da LogP 2.74 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc2cc(C(=O)O)ccc2c1
|
| ZINC6535079 ZINC | 0.654 | 204.2 Da LogP 1.95 TPSA 77.8 | ✓ Ro5 | Alert |
O=C(O)c1ccc2cc(O)c(O)cc2c1
|
| ZINC1667321 ZINC | 0.645 | 200.2 Da LogP 3.14 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCC(=O)c1ccc2ccccc2c1O
|
| ZINC19837284 ZINC | 0.645 | 201.2 Da LogP 1.90 TPSA 49.3 | ✓ Ro5 | ✓ Clean |
CNC(=O)c1ccc2ccccc2c1O
|
| ZINC2516359 ZINC | 0.645 | 238.3 Da LogP 4.12 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
Cc1ccccc1CCC(=O)c1ccccc1C
|
| ZINC2516382 ZINC | 0.645 | 252.4 Da LogP 4.43 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
Cc1ccccc1CCC(=O)c1c(C)cccc1C
|
| ZINC2378594 ZINC | 0.643 | 224.2 Da LogP 3.58 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=C(c1ccc2ccccc2c1)C(F)(F)F
|
| ZINC3132463 ZINC | 0.643 | 212.3 Da LogP 4.07 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(C)(C)C(=O)c1ccc2ccccc2c1
|
| ZINC394670686 ZINC | 0.643 | 273.5 Da LogP 4.39 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=C(c1ccc2ccccc2c1)C(Cl)(Cl)Cl
|
| ZINC1089845 ZINC | 0.640 | 210.3 Da LogP 3.50 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=C(CCc1ccccc1)c1ccccc1
|
| ZINC15780483 ZINC | 0.640 | 224.3 Da LogP 3.43 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=C(CCc1ccccc1)Cc1ccccc1
|
| ZINC1663872 ZINC | 0.640 | 276.1 Da LogP 2.31 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)CCc1ccc(I)cc1
|
| ZINC2574309 ZINC | 0.640 | 229.1 Da LogP 2.47 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)CCc1ccc(Br)cc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.