KpATCC43816 Protein target profile

sugar (and other) transporter family protein

Accession: VK055_0865

Gene: AIK79488.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A422Z2I4
Length 422
Pocket druggability (P2Rank · AlphaFold DB model) 0.942
Direct ligand evidence 0 88 total records
Functional annotation 0 EC 3 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
31.707 Lower values reduce human off-target concern.
Human E-value
2.63e-07
Gut microbiome similarity
0.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
34.198 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
92.33 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.942
Structure A0A422Z2I4
Pocket Pocket 1
Druggability (FPocket) 0.819
Structure A0A422Z2I4
Pocket Pocket 8
ColabFold model
P2Rank 0.931 · Pocket 1
FPocket 0.958 · Pocket 30
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 13 / 4744 genomes with a hit
Prevalence 0.3%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MWLAIAINYIDRTVLSAAAPHLIDELKLDPEMMGFIMAAFFWSYSLLQIPAGWFADRFGQKKGLGLAVAWWSIATSMMGVATGFKSLLALRLALGVGEAAAYPSNAGIAARWFPDKERATVSGLFDSASKFGGAIAMPLIVWMIYTFDWRLTFLIIGSVGILWVIAWYFIYAENPEEHKRISPSEVRIIRDGQKQHHGDKTVLPMKWYKLLRYRNIWAMCIGFFTINYTSYFFITWLPTYLVKEKGMDFIKMGMVAALPLLCGMVIEVFAGWASDRLVHKKVLSLTATRKLFLTIGLLMALCIGFAPFTDSVFMTVFLLCVAKSGTTVAASQVWALPGDVAPKNSVSIVAGLQNTVSNMGGAVGPIITGAIVAATGSFNWALIFSAILVVIGIINYLFLMGKIEPINDKGGKSPVLNAAEQH

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

3
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

42 records
Show feature table
Start End DB Term Name
52 62 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
1 31 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
2 365 Pfam PF07690 Major Facilitator Superfamily
2 365 InterPro IPR011701 Major facilitator superfamily
1 402 SUPERFAMILY SSF103473 MFS general substrate transporter
1 402 InterPro IPR036259 MFS transporter superfamily
1 182 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
1 182 InterPro IPR036259 MFS transporter superfamily
1 404 ProSiteProfiles PS50850 Major facilitator superfamily (MFS) profile.
1 404 InterPro IPR020846 Major facilitator superfamily domain
63 84 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
149 171 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
400 422 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
172 215 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
124 145 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
85 89 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
295 317 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
249 270 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
337 355 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
151 171 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
291 308 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
146 150 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
215 237 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
205 408 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
205 408 InterPro IPR036259 MFS transporter superfamily
3 399 CDD cd17319 MFS_ExuT_GudP_like
380 399 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
309 313 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
3 402 PANTHER PTHR11662 SOLUTE CARRIER FAMILY 17
33 55 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
252 274 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
32 51 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
375 379 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
90 112 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
216 237 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
356 374 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
62 84 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
113 123 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
271 290 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
377 399 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
314 336 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
238 248 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.942
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.166
Likely same site as FPocket 7 1.8 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.076
Likely same site as FPocket 8 2.5 Å 6 shared residues 67% of smaller site
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.048
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.021
Likely same site as FPocket 16 3.0 Å 6 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #8
0.819
Likely same site as P2Rank 3 2.5 Å 6 shared residues 67% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #2
0.801
Show in viewer
Surrounding area
Pocket 3 FPocket #7
0.714
Likely same site as P2Rank 2 1.8 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 4 FPocket #16
0.59
Likely same site as P2Rank 5 3.0 Å 6 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A422Z2I4
AlphaFold DB full sequence Viewing
ColabFold VK055_0865
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

88 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 38 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 37 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
J0M PDB via homolog 196.2 Da · LogP -3.49 · TPSA 138.5 Open detail RCSB PDB
CHEMBL236247 ChEMBL via homolog · pchembl 8.70 (~2.0 nM) Detail ChEMBL
CHEMBL238371 ChEMBL via homolog · pchembl 8.30 (~5.0 nM) Detail ChEMBL
CHEMBL1200712 ChEMBL via homolog · pchembl 7.40 (~39.8 nM) Detail ChEMBL
CHEMBL3218305 ChEMBL via homolog · pchembl 7.10 (~79.4 nM) Detail ChEMBL

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
J0M RCSB PDB J7QAK3 196.2 Da LogP -3.49 TPSA 138.5 1 viol. ✓ Clean C([C@H]([C@@H]([C@@H]([C@H](C(=O)O)O)O)O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.