KpATCC43816 Protein target profile

ydeA MFS transporter

Accession: VK055_0867

Gene: AIK79490.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GX94
Export view
Length 384
Pocket druggability (P2Rank · AlphaFold DB model) 0.986
Functional annotation 0 EC 3 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Second pocket predictor agrees P2Rank predicted binding-site probability 0.99. Structure available AlphaFold DB model + ColabFold model

Risks to review

Microbiome similarity 123 of 4744 screened genomes (2.6%) have a significant similarity hit. This target also has a predicted binding pocket (P2Rank 0.99) — check the ligand evidence before deprioritizing on off-target risk alone. Mixed conservation Core/accessory calls are not fully concordant. Best pocket may be a modeling artifact FPocket selected-pocket score 0.91, but this pocket's geometry is unusually large/diffuse compared to this protein's other predicted pockets — may reflect a low-confidence or disordered model region rather than a real cavity.

Evidence gaps

No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
49.862 Higher values support similarity to known essential genes.
DEG E-value
9.69e-118 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
90.69 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.986
Structure A0A0H3GX94
Pocket Pocket 1
Druggability (FPocket) 0.91
Structure A0A0H3GX94
Pocket Pocket 3
ColabFold model
P2Rank 0.982 · Pocket 1
FPocket 0.641 · Pocket 17
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 123 / 4744 genomes with a hit
Prevalence 2.6%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GX94

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MTLAIAAFIFNTTEFAPVGLLSDIADSFGMETAQVGMMLTIYAWVVALMSLPFMLLTSKVERRRLLIGLFILFIASHVLSFFAWNFDVLVISRIGIAFAHAVFWSITSALAIRMAPPGKRAQALSLIATGTALAMVFGIPIGRIIGQYFGWRMTFLAIGLGALATLACLVKLLPTLPSEHSGSLKSLPVLFRRPALVSVYILTVVVVTAHYTAYSYIEPFVQTVAGLSGNFATVLLLILGGAGIIGSIVFGKLGNQHASGLISLAIALLLACLLLLLPASHNPQHLMLLSIFWGVAIMIIGLGMQVKVLASAPDATDVAMSLFSGIFNIGIGAGALVGSQVSLHLSMASVGYVGAIPALVALVWSLMIFRRWPVSLEDHQPHHS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

3
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

48 records
Show feature table
Start End DB Term Name
229 249 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
16 38 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
64 86 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
281 285 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
231 250 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
349 369 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 373 ProSiteProfiles PS50850 Major facilitator superfamily (MFS) profile.
1 373 InterPro IPR020846 Major facilitator superfamily domain
85 89 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
124 145 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
90 112 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
307 317 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
2 373 PANTHER PTHR43124 PURINE EFFLUX PUMP PBUE
146 150 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
318 337 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
3 10 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
195 217 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
151 173 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
39 58 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
261 280 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
218 228 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
194 216 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
289 311 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
124 146 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
3 312 Pfam PF07690 Major Facilitator Superfamily
3 312 InterPro IPR011701 Major facilitator superfamily
3 372 SUPERFAMILY SSF103473 MFS general substrate transporter
3 372 InterPro IPR036259 MFS transporter superfamily
338 348 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
286 306 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
257 279 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
250 260 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
59 64 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
1 2 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
11 15 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 15 Phobius SIGNAL_PEPTIDE Signal peptide region
370 384 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
3 366 CDD cd17324 MFS_NepI_like
151 174 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 369 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
1 369 InterPro IPR036259 MFS transporter superfamily
347 369 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
90 112 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
65 84 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
318 337 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
113 123 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
35 57 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
175 194 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.986
Likely same site as FPocket 3 6.0 Å 20 shared residues 87% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.373
Likely same site as FPocket 7 0.7 Å 10 shared residues 91% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.139
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.034
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.031
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #3
0.91 Unusual size
Likely same site as P2Rank 1 6.0 Å 20 shared residues 87% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #4
0.49
Show in viewer
Surrounding area
Pocket 3 FPocket #5
0.237
Show in viewer
Surrounding area
Pocket 4 FPocket #7
0.236
Likely same site as P2Rank 2 0.7 Å 10 shared residues 91% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GX94
AlphaFold DB — — full sequence — Viewing
ColabFold VK055_0867
ColabFold — — full sequence — Loaded