KpATCC43816 Protein target profile

urea ABC transporter, permease protein UrtC

Accession: VK055_0878

Gene: urtC AIK79501.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GPM7
Export view
Length 357
Pocket druggability (P2Rank · AlphaFold DB model) 0.611
Functional annotation 0 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Second pocket predictor agrees P2Rank predicted binding-site probability 0.61. Structure available AlphaFold DB model + ColabFold model

Risks to review

Microbiome similarity 106 of 4744 screened genomes (2.2%) have a significant similarity hit. This target also has a predicted binding pocket (P2Rank 0.61) — check the ligand evidence before deprioritizing on off-target risk alone. Best pocket may be a modeling artifact FPocket selected-pocket score 0.91, but this pocket's geometry is unusually large/diffuse compared to this protein's other predicted pockets — may reflect a low-confidence or disordered model region rather than a real cavity.

Evidence gaps

No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
62.006 Higher values support similarity to known essential genes.
DEG E-value
5.01e-143 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
89.78 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.611
Structure A0A0H3GPM7
Pocket Pocket 1
Druggability (FPocket) 0.905
Structure A0A0H3GPM7
Pocket Pocket 32
ColabFold model
P2Rank 0.7 · Pocket 1
FPocket 0.919 · Pocket 23
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 106 / 4744 genomes with a hit
Prevalence 2.2%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSQPITLTLAQRAPRPLRWLGILLVLGLLSMPFLALLPASHPLAVPSWLLTLSGKILCYAIVAVALDLVWGYAGMLSLGHGIFFALGGYAMGMYLMRQAAGDGLPAFMSFLSWSELPWFWWGTQHFAWAMALVVLVPGLLALVFGWFAFRSKIKGVYFSIMTQALTYAGMLLFFRNETGFGGNNGFTGFTTLLGFPVTATGTRASLFMATVLLLLLTLWLGAALAQSKFGRILTAVRDAENRLMFCGYDPRGFKLLVWTLSAVLCGLAGALYVPQVGIINPSEMSPTNSIEAAIWVALGGRGTLIGPVLGAGLVNGAKSIFTVAMPEYWQLFLGLIFIIVTLFLPSGVMGLLRRGDR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

5
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0015658 Enables the transfer of branched-chain amino acids from one side of a membrane to the other. Branched-chain amino acids are amino acids with a branched carbon skeleton without rings.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

37 records
Show feature table
Start End DB Term Name
56 350 CDD cd06581 TM_PBP1_LivM_like
56 350 InterPro IPR043428 High-affinity branched-chain amino acid transport system permease protein LivM-like
328 352 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
175 203 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
43 351 NCBIfam TIGR03408 urea ABC transporter permease subunit UrtC
43 351 InterPro IPR017778 ABC transporter, urea, permease protein, UrtC
78 96 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 16 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
150 155 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
204 225 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
52 340 Pfam PF02653 Branched-chain amino acid transport system / permease component
52 340 InterPro IPR001851 ABC transporter, permease
122 126 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
32 354 PANTHER PTHR30482 HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANSPORT SYSTEM PERMEASE
32 354 InterPro IPR043428 High-affinity branched-chain amino acid transport system permease protein LivM-like
17 37 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
252 273 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
353 357 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
329 351 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
155 174 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
44 66 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
257 279 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
292 314 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
226 251 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
17 39 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
204 226 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
73 95 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
103 121 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
73 77 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
126 148 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
274 327 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
38 48 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
97 102 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
178 197 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
156 174 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
127 149 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
49 72 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.611
Likely same site as FPocket 17 4.6 Å 9 shared residues 75% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.453
Likely same site as FPocket 32 7.1 Å 10 shared residues 67% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.274
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.089
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.064
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #32
0.905 Unusual size
Likely same site as P2Rank 2 7.1 Å 10 shared residues 67% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #17
0.833
Likely same site as P2Rank 1 4.6 Å 9 shared residues 75% of smaller site
Show in viewer
Surrounding area
Pocket 3 FPocket #3
0.455
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GPM7
AlphaFold DB — — full sequence — Viewing
ColabFold VK055_0878
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GPM7