KpATCC43816 Protein target profile

mdtI SMR Protein

Accession: VK055_0936

Gene: mdtI AIK79559.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GPF5
Length 109
Pocket druggability (FPocket · AlphaFold DB model) 0.881
Direct ligand evidence 0 54 total records
Functional annotation 0 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
84.404 Higher values support similarity to known essential genes.
DEG E-value
8.14e-57 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
90.98 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank)
Structure A0A0H3GPF5
Pocket No pockets
Druggability (FPocket) 0.881
Structure A0A0H3GPF5
Pocket Pocket 3
ColabFold model
P2Rank 0.005 · Pocket 1
FPocket 0.322 · Pocket 1
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 122 / 4744 genomes with a hit
Prevalence 2.6%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MQQFEWIHAAWLAIAIVLEIIANVFLKFSDGFRRKIYGILSLAAVLGAFSALSQAVKGIDLSVAYALWGGFGIAATIAAGWVLFGQRLNNKGWAGVILLVAGMVLIKLA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

5
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0015606 Enables the transfer of spermidine, N-(3-aminopropyl)-1,4-diaminobutane, from one side of a membrane to the other.
  • GO:0015848 The directed movement of spermidine, N-(3-aminopropyl)-1,4-diaminobutane, a polyamine formed by the transfer of a propylamine group from decarboxylated S-adenosylmethionine to putrescine, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

22 records
Show feature table
Start End DB Term Name
6 25 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
109 109 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
36 53 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
5 99 Pfam PF00893 Small Multidrug Resistance protein
5 99 InterPro IPR045324 Small multidrug resistance protein
92 106 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 109 Hamap MF_01597 Spermidine export protein MdtI [mdtI].
1 109 InterPro IPR023737 Spermidine export protein MdtI
37 56 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
5 109 FunFam G3DSA:1.10.3730.20:FF:000001 Quaternary ammonium compound resistance transporter SugE
57 61 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 5 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
12 108 SUPERFAMILY SSF103481 Multidrug resistance efflux transporter EmrE
62 84 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
26 36 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
85 90 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
7 109 Gene3D G3DSA:1.10.3730.20 -
10 29 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
63 85 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
91 108 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
10 108 PANTHER PTHR30561 SMR FAMILY PROTON-DEPENDENT DRUG EFFLUX TRANSPORTER SUGE
10 108 InterPro IPR000390 Small drug/metabolite transporter protein family

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #3
0.881
Show in viewer
Surrounding area
Pocket 2 FPocket #4
0.364
Show in viewer
Surrounding area
Pocket 3 FPocket #1
0.343
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GPF5
AlphaFold DB full sequence Viewing
ColabFold VK055_0936
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

54 records
Chemistry signal

Bioactivity evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 4 records from similar proteins
Structural ligands 0 0 loaded crystals
Measured bioactivity 4 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
CHEMBL891 ChEMBL via homolog pchembl 8.40 (~4.0 nM) 435.9 Da · LogP 2.55 · TPSA 112.7 Open detail ChEMBL
CHEMBL158 ChEMBL via homolog · pchembl 8.22 (~6.0 nM) Detail ChEMBL
CHEMBL333078 ChEMBL via homolog · pchembl 6.52 (~302.0 nM) Detail ChEMBL
CHEMBL224214 ChEMBL via homolog Detail ChEMBL
ZINC15848211 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

Show only:
Ligand UniProt (homolog) pchembl MW · LogP · TPSA Lipinski PAINS SMILES
CHEMBL891 ChEMBL Q3S5C3 8.40 ~4.0 nM 435.9 Da LogP 2.55 TPSA 112.7 ✓ Ro5 ✓ Clean Cc1onc(-c2ccccc2Cl)c1C(=O)N[C@@H]1C(=O)N2[C@@H]…
CHEMBL158 ChEMBL Q3S5C3 8.22 ~6.0 nM 435.4 Da LogP -1.17 TPSA 201.6 ✓ Ro5 ✓ Clean C[C@H]1[C@H](NC(=O)/C(=N\OC(C)(C)C(=O)O)c2csc(N…
CHEMBL333078 ChEMBL Q3S5C3 6.52 ~302.0 nM 270.3 Da LogP -0.74 TPSA 115.5 ✓ Ro5 ✓ Clean C[C@]1(/C=C\C#N)[C@H](C(=O)O)N2C(=O)C[C@H]2S1(=…
CHEMBL224214 ChEMBL Q2FD83 204.6 Da LogP 2.16 TPSA 72.0 ✓ Ro5 Alert N#CC(C#N)=NNc1cccc(Cl)c1

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.