KpATCC43816 Protein target profile
beta-ketoadipate pathway transcriptional regulator, PcaR/PcaU/PobR family protein
Accession: VK055_0967
Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 0.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 35.081 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 89.9 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MDKHPDDLLTGDGDPFKGDPNFMASLARGLEVIQAFTPQRPLLSISQISQKTGIPRAAVRRCLYTLSKLGFVYAEDGKNFQLRPRILALGHAWLASTPLARSAQPVLRHLSEMLNESCSIATLDGDDILYIARASSSRIMTIDLDIGSRLPAWATSMGRVLLSHQPEEKLNDMLARVTMIRYTPQTVDSVAKLRAELKRVHQQGYALNDQELEMGLRSLAVPLFNAQGQVQAALNVGVHAGQMTAREMIERVLPELQKAARELTLLLR
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
4- GO:0045893 Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
- GO:0046278 The chemical reactions and pathways involving protocatechuate, the anion of protocatechuic acid (3,4-dihydroxybenzoic acid).
- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 18 | 268 | PANTHER | PTHR30136 | HELIX-TURN-HELIX TRANSCRIPTIONAL REGULATOR, ICLR FAMILY |
| 23 | 112 | SMART | SM00346 | iclrneu |
| 23 | 112 | InterPro | IPR005471 | Transcription regulator IclR, N-terminal |
| 14 | 90 | Gene3D | G3DSA:1.10.10.10 | - |
| 14 | 90 | InterPro | IPR036388 | Winged helix-like DNA-binding domain superfamily |
| 23 | 84 | ProSiteProfiles | PS51077 | IclR-type HTH domain profile. |
| 23 | 84 | InterPro | IPR005471 | Transcription regulator IclR, N-terminal |
| 89 | 267 | SUPERFAMILY | SSF55781 | GAF domain-like |
| 20 | 265 | NCBIfam | TIGR02431 | beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family |
| 20 | 265 | InterPro | IPR012794 | Beta-ketoadipate transcriptional regulator, PcaR/PcaU/PobR |
| 24 | 95 | SUPERFAMILY | SSF46785 | Winged helix DNA-binding domain |
| 24 | 95 | InterPro | IPR036390 | Winged helix DNA-binding domain superfamily |
| 91 | 268 | Gene3D | G3DSA:3.30.450.40 | - |
| 91 | 268 | InterPro | IPR029016 | GAF-like domain superfamily |
| 85 | 268 | ProSiteProfiles | PS51078 | IclR effector binding domain profile. |
| 85 | 268 | InterPro | IPR014757 | Transcription regulator IclR, C-terminal |
| 140 | 264 | Pfam | PF01614 | Bacterial transcriptional regulator |
| 140 | 264 | InterPro | IPR014757 | Transcription regulator IclR, C-terminal |
| 25 | 73 | Pfam | PF09339 | IclR helix-turn-helix domain |
| 25 | 73 | InterPro | IPR005471 | Transcription regulator IclR, N-terminal |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GPC3
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_0967
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 3HB RCSB PDB | Q43992 | 138.1 Da LogP 1.09 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
c1cc(cc(c1)O)C(=O)O
|
|
| GOA RCSB PDB | P16528 | 76.1 Da LogP -0.94 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C(C(=O)O)O
|
|
| PHB RCSB PDB | Q9Z4X2 | 138.1 Da LogP 1.09 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1C(=O)O)O
|
|
| PYR RCSB PDB | P16528 | 88.1 Da LogP -0.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CC(=O)C(=O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC389804 ZINC | 0.842 | 214.2 Da LogP 2.76 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(O)cc2)cc1
|
| ZINC33246180 ZINC | 0.727 | 242.2 Da LogP 3.51 TPSA 82.2 | ✓ Ro5 | Alert |
O=C(O)c1ccc(N=Nc2ccc(O)cc2)cc1
|
| ZINC3896282 ZINC | 0.727 | 242.2 Da LogP 3.51 TPSA 82.2 | ✓ Ro5 | Alert |
O=C(O)c1ccc(/N=N/c2ccc(O)cc2)cc1
|
| ZINC392302 ZINC | 0.727 | 230.2 Da LogP 2.88 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccc(O)cc2)cc1
|
| ZINC39410336 ZINC | 0.727 | 242.2 Da LogP 2.16 TPSA 74.6 | ✓ Ro5 | Alert |
O=C(C(=O)c1cccc(O)c1)c1cccc(O)c1
|
| ZINC289893 ZINC | 0.696 | 278.3 Da LogP 1.92 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(S(=O)(=O)c2ccc(O)cc2)cc1
|
| ZINC114185151 ZINC | 0.667 | 298.2 Da LogP 2.15 TPSA 108.7 | ✓ Ro5 | Alert |
O=C(O)c1ccc(C(=O)C(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC2924369 ZINC | 0.667 | 242.2 Da LogP 2.16 TPSA 74.6 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccc(O)cc1)c1ccc(O)cc1
|
| ZINC3156317 ZINC | 0.640 | 258.2 Da LogP 2.31 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(OC(=O)c2ccc(O)cc2)cc1
|
| ZINC4903179 ZINC | 0.640 | 257.2 Da LogP 2.34 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(NC(=O)c2ccc(O)cc2)cc1
|
| ZINC134079 ZINC | 0.632 | 242.2 Da LogP 2.75 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(C(=O)O)cc2)cc1
|
| ZINC1640789 ZINC | 0.632 | 374.3 Da LogP 3.55 TPSA 108.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccc(C(=O)c3ccc(C(=O)O)cc3)cc…
|
| ZINC2146859 ZINC | 0.632 | 270.2 Da LogP 2.31 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC28449 ZINC | 0.632 | 214.2 Da LogP 2.33 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(c1ccc(O)cc1)c1ccc(O)cc1
|
| ZINC3147211 ZINC | 0.632 | 318.3 Da LogP 4.42 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-c3ccc(C(=O)O)cc3)cc2)cc1
|
| ZINC332365 ZINC | 0.632 | 318.3 Da LogP 3.56 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(c1ccc(O)cc1)c1ccc(C(=O)c2ccc(O)cc2)cc1
|
| ZINC1705144 ZINC | 0.619 | 226.2 Da LogP 2.46 TPSA 54.4 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccc(O)cc1)c1ccccc1
|
| ZINC65347101 ZINC | 0.594 | 215.2 Da LogP 2.15 TPSA 70.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccnc(-c2cccc(O)c2)c1
|
| ZINC6338454 ZINC | 0.593 | 268.3 Da LogP 2.99 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(/C=C/C(=O)c2ccc(O)cc2)cc1
|
| ZINC65340137 ZINC | 0.583 | 258.2 Da LogP 2.46 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(C(=O)O)cc(-c2ccc(O)cc2)c1
|
| ZINC167226 ZINC | 0.577 | 248.0 Da LogP 1.99 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(I)c1
|
| ZINC404749 ZINC | 0.577 | 201.0 Da LogP 2.15 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(Br)c1
|
| ZINC409186 ZINC | 0.577 | 226.2 Da LogP 2.62 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(C(=O)c2ccccc2)c1
|
| ZINC167246 ZINC | 0.571 | 248.0 Da LogP 1.99 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(I)cc1
|
| ZINC3269660 ZINC | 0.571 | 254.2 Da LogP 2.45 TPSA 71.4 | ✓ Ro5 | Alert |
O=C(O)c1ccc(C(=O)C(=O)c2ccccc2)cc1
|
| ZINC34573580 ZINC | 0.571 | 496.5 Da LogP 4.86 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(c2ccc(C(=O)O)cc2)(c2ccc(C(=O)O)cc…
|
| ZINC388063 ZINC | 0.571 | 201.0 Da LogP 2.15 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Br)cc1
|
| ZINC896125 ZINC | 0.571 | 246.2 Da LogP 1.74 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
O=C(c1cccc(O)c1)c1c(O)cc(O)cc1O
|
| ZINC2528073 ZINC | 0.567 | 213.2 Da LogP 2.64 TPSA 49.3 | ✓ Ro5 | ✓ Clean |
O=C(Nc1ccccc1)c1cccc(O)c1
|
| ZINC2558112 ZINC | 0.567 | 214.2 Da LogP 2.61 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(Oc1ccccc1)c1cccc(O)c1
|
| ZINC38167261 ZINC | 0.567 | 208.2 Da LogP 0.62 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
O=C(O)C(=O)CC(=O)c1cccc(O)c1
|
| ZINC6732169 ZINC | 0.567 | 208.2 Da LogP 0.94 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
O=C(O)C(=O)/C=C(\O)c1cccc(O)c1
|
| ZINC571052 ZINC | 0.559 | 241.2 Da LogP 2.84 TPSA 69.9 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(/N=C/c2cccc(O)c2)c1
|
| ZINC1687604 ZINC | 0.552 | 214.2 Da LogP 2.33 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(c1cccc(O)c1)c1ccccc1O
|
| ZINC1812572 ZINC | 0.552 | 300.3 Da LogP 1.26 TPSA 98.7 | ✓ Ro5 | ✓ Clean |
O=C(NCCNC(=O)c1cccc(O)c1)c1cccc(O)c1
|
| ZINC5234593 ZINC | 0.552 | 293.3 Da LogP 1.89 TPSA 103.7 | ✓ Ro5 | Alert |
O=C(O)c1ccc(S(=O)(=O)Nc2ccc(O)cc2)cc1
|
| ZINC102314234 ZINC | 0.548 | 210.3 Da LogP 2.14 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C/C(=C(\S)C(=O)O)c1cccc(O)c1
|
| ZINC115778137 ZINC | 0.548 | 216.2 Da LogP 1.55 TPSA 83.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccc(-c2ncc(O)cn2)c1
|
| ZINC20266271 ZINC | 0.548 | 233.3 Da LogP 2.80 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
O=C(c1cccc(O)c1)N1CCCCCCC1
|
| ZINC6760627 ZINC | 0.548 | 205.3 Da LogP 2.02 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
O=C(c1cccc(O)c1)N1CCCCC1
|
| ZINC13375284 ZINC | 0.545 | 270.2 Da LogP 3.50 TPSA 99.3 | ✓ Ro5 | Alert |
O=C(O)c1ccc(N=Nc2ccc(C(=O)O)cc2)cc1
|
| ZINC156520 ZINC | 0.545 | 268.3 Da LogP 3.25 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(/C=C/c2ccc(C(=O)O)cc2)cc1
|
| ZINC1651850 ZINC | 0.545 | 270.3 Da LogP 2.87 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(CCc2ccc(C(=O)O)cc2)cc1
|
| ZINC1759946 ZINC | 0.545 | 256.3 Da LogP 2.67 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Cc2ccc(C(=O)O)cc2)cc1
|
| ZINC1857524265 ZINC | 0.545 | 268.3 Da LogP 3.25 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C=Cc2ccc(C(=O)O)cc2)cc1
|
| ZINC241160 ZINC | 0.545 | 258.2 Da LogP 2.88 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccc(C(=O)O)cc2)cc1
|
| ZINC2504355 ZINC | 0.545 | 226.2 Da LogP 2.62 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccccc2)cc1
|
| ZINC4792283 ZINC | 0.545 | 268.3 Da LogP 3.25 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(/C=C\c2ccc(C(=O)O)cc2)cc1
|
| ZINC8418684 ZINC | 0.545 | 257.2 Da LogP 2.83 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Nc2ccc(C(=O)O)cc2)cc1
|
| ZINC96024941 ZINC | 0.545 | 366.4 Da LogP 3.88 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C#Cc2ccc(C#Cc3ccc(C(=O)O)cc3)cc2)cc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.