KpATCC43816 Protein target profile

NADH-azoreductase, FMN-dependent

Accession: VK055_1027

Gene: AIK79650.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GSP2
Length 201
Pocket druggability (P2Rank · AlphaFold DB model) 0.06
Direct ligand evidence 0 63 total records
Functional annotation 2 EC 4 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
92.04 Higher values support similarity to known essential genes.
DEG E-value
7.57e-137 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
98.06 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.06
Structure A0A0H3GSP2
Pocket Pocket 1
Druggability (FPocket) 0.304
Structure A0A0H3GSP2
Pocket Pocket 2
ColabFold model
P2Rank 0.052 · Pocket 1
FPocket 0.293 · Pocket 3
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 142 / 4744 genomes with a hit
Prevalence 3.0%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSKVLVLKSSILAGYSQSGQLSDYFVEQWQEKHPGDEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKGNDVIVIAAPMYNFNIPTQLKNYFDLVARAGVTFRYTEKGPEGLVTGKRAVVVTSRGGIHKDTPTDLVTPYLSTFLGFIGITDVNFVFAEGIAYGPEVAAKAQSDAKAAIDSVVAA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 EC 4 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

2

Gene Ontology (GO)

4
  • GO:0016655 Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces a quinone or a similar acceptor molecule.
  • GO:0010181 Binding to flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
  • GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.
  • GO:0016652 Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces NAD+ or NADP.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
1 201 FunFam G3DSA:3.40.50.360:FF:000010 FMN-dependent NADH-azoreductase
1 199 SUPERFAMILY SSF52218 Flavoproteins
1 199 InterPro IPR029039 Flavoprotein-like superfamily
1 18 Phobius SIGNAL_PEPTIDE Signal peptide region
14 18 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
3 195 Pfam PF02525 Flavodoxin-like fold
3 195 InterPro IPR003680 Flavodoxin-like fold
2 199 Hamap MF_01216 FMN dependent NADH:quinone oxidoreductase [azoR].
2 199 InterPro IPR023048 NADH:quinone oxidoreductase, FMN-dependent
19 201 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
4 13 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 200 PANTHER PTHR43741 FMN-DEPENDENT NADH-AZOREDUCTASE 1
1 201 Gene3D G3DSA:3.40.50.360 -
1 201 InterPro IPR029039 Flavoprotein-like superfamily
1 3 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.06
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.048
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.014
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.005
Likely same site as FPocket 2 0.5 Å 6 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2
0.304
Likely same site as P2Rank 4 0.5 Å 6 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:10-10
UniProt: Binding site:140-143
UniProt: Binding site:16-18
UniProt: Binding site:96-99
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GSP2
AlphaFold DB full sequence Viewing
ColabFold VK055_1027
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

63 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 13 records from similar proteins
Structural ligands 13 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
12P PDB via homolog 546.7 Da · LogP -0.85 · TPSA 142.0 Open detail RCSB PDB
AQN PDB via homolog Detail RCSB PDB
BLQ PDB via homolog Detail RCSB PDB
CBD PDB via homolog Detail RCSB PDB
DTC PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
12P RCSB PDB Q88IY3 546.7 Da LogP -0.85 TPSA 142.0 2 viol. ✓ Clean C(COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO)O
AQN RCSB PDB Q88IY3 288.3 Da LogP 1.71 TPSA 88.5 ✓ Ro5 Alert c1ccc2c(c1)C(=O)c3ccc(cc3C2=O)S(=O)(=O)O
BLQ RCSB PDB Q9I5F3 357.3 Da LogP 0.81 TPSA 145.2 ✓ Ro5 Alert c1cc(ccc1C(=O)NCCC(=O)O)N/N=C/2\C=CC(=O)C(=C2)C…
CBD RCSB PDB C0STY1 774.2 Da LogP 3.85 TPSA 298.0 3 viol. Alert c1ccc2c(c1)C(=O)c3c(cc(c(c3C2=O)N)S(=O)(=O)O)Nc…
DTC RCSB PDB P41407 336.3 Da LogP 2.21 TPSA 86.7 ✓ Ro5 ✓ Clean c1ccc2c(c1)C(=O)C(C(=O)O2)CC3C(=O)c4ccccc4OC3=O
FD5 RCSB PDB Q88IY3 1180.2 Da LogP 5.33 TPSA 503.1 4 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=NC(=O)N(C(=O)C3=N2)OCCS(c4ccc…
MRE RCSB PDB Q9I5F3 269.3 Da LogP 3.87 TPSA 65.3 ✓ Ro5 Alert CN(C)c1ccc(cc1)/N=N/c2ccccc2C(=O)O
NFZ RCSB PDB Q9I5F3 198.1 Da LogP 0.19 TPSA 123.8 ✓ Ro5 ✓ Clean c1cc(oc1\C=N\NC(=O)N)[N+](=O)[O-]
NHE RCSB PDB G9QLG5 207.3 Da LogP 0.80 TPSA 66.4 ✓ Ro5 ✓ Clean C1CCC(CC1)NCCS(=O)(=O)O
ORI RCSB PDB C0STY1 328.3 Da LogP 4.21 TPSA 99.3 ✓ Ro5 Alert c1ccc2c(c1)c(ccc2O)/N=N/c3ccc(cc3)S(=O)(=O)O
PE8 RCSB PDB G9QLG5 370.4 Da LogP -0.91 TPSA 105.1 ✓ Ro5 ✓ Clean C(COCCOCCOCCOCCOCCOCCOCCO)O
RE8 RCSB PDB C0STY1 378.4 Da LogP 5.36 TPSA 99.3 1 viol. Alert c1ccc2c(c1)ccc(c2/N=N/c3ccc(c4c3cccc4)S(=O)(=O)…
UQ1 RCSB PDB Q9I5F3 250.3 Da LogP 2.32 TPSA 52.6 ✓ Ro5 Alert CC1=C(C(=O)C(=C(C1=O)OC)OC)CC=C(C)C

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.