KpATCC43816 Protein target profile

zinc-binding dehydrogenase family protein

Accession: VK055_1076

Gene: AIK79699.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GS18

Export view

Length 344

Pocket druggability (P2Rank · AlphaFold DB model) 0.953

Direct ligand evidence 0 59 total records

Functional annotation 0 EC 2 GO

Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Second pocket predictor agrees P2Rank predicted binding-site probability 0.95. Structure available AlphaFold DB model + ColabFold model Ligand evidence via structure/bioactivity 9 structural and 0 bioactivity records.

Risks to review

Evidence coverage

Core evidence streams are available for this target.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target: Hit
Human identity (%): 48.077 Lower values reduce human off-target concern.
Human E-value: 7.26e-06
Gut microbiome similarity: 0.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG): N
DEG identity (%): 32.937 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT: 96.17 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.953

Structure A0A0H3GS18

Pocket Pocket 1

Druggability (FPocket) 0.805

Structure A0A0H3GS18

Pocket Pocket 13

ColabFold model

P2Rank 0.943 · Pocket 1

FPocket 0.632 · Pocket 9

Core conservation Accessory gene

Roary core

CoreCruncher accessory

Gut microbiome 7 / 4744 genomes with a hit

Prevalence 0.1%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSTQMMKAVQQHAFGGPEVLSYEDAPMPVLQAGEVLVQVHAVGVNPPDSYLRDGYQQLPPEWRPEVRFPLILGTDLSGVVVARADDVREVAVGDEVYAMARFPEGAAGGSRAYAEYVSVPVSDLARKPLTLSHQQAAAVPMSLLTAWQFMIDPGHEVANPLQPGPHRPVPLAGKRVLVNGAAGGVGHFAVQLAKWQGAEVIAVAAGRHEAFLRQLGADSVIDYTTTAVEETVRDLDLVIDAPGGPASGRFLRTLRPGGALYPIFPLGFAGTEEARQRGVTVSTTQVRSSGAQLARLADLLDAGVIRVAIDSVFPLAQAQMAHERAAQGHLEGKIVLSVMDSSAG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Subcellular localization

Localization: Cytoplasmic

Gene Ontology (GO)

GO:0008270 Binding to a zinc ion (Zn).
GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records

Show feature table

Start	End	DB	Term	Name
13	335	Gene3D	G3DSA:3.90.180.10	-
2	158	SUPERFAMILY	SSF50129	GroES-like
2	158	InterPro	IPR011032	GroES-like superfamily
6	336	CDD	cd05289	MDR_like_2
131	303	SUPERFAMILY	SSF51735	NAD(P)-binding Rossmann-fold domains
131	303	InterPro	IPR036291	NAD(P)-binding domain superfamily
173	194	ProSitePatterns	PS01162	Quinone oxidoreductase / zeta-crystallin signature.
173	194	InterPro	IPR002364	Quinone oxidoreductase/zeta-crystallin, conserved site
15	336	SMART	SM00829	PKS_ER_names_mod
15	336	InterPro	IPR020843	Polyketide synthase, enoylreductase domain
33	105	Pfam	PF08240	Alcohol dehydrogenase GroES-like domain
33	105	InterPro	IPR013154	Alcohol dehydrogenase-like, N-terminal
142	287	Gene3D	G3DSA:3.40.50.720	-
2	338	PANTHER	PTHR11695	ALCOHOL DEHYDROGENASE RELATED
215	336	Pfam	PF13602	Zinc-binding dehydrogenase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low

How colors and pocket overlays are used

Uniform protein color marks the displayed model as a single molecular object.

Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.

Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.

'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.

'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.

'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.

Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1

0.953

Likely same site as FPocket 5 5.8 Å 23 shared residues 70% of smaller site

Show in viewer

Surrounding area

Pocket 2 P2Rank #2

0.009

Show in viewer

Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #13

0.805 Unusual size

Show in viewer

Surrounding area

Pocket 2 FPocket #5

0.57 Unusual size

Likely same site as P2Rank 1 5.8 Å 23 shared residues 70% of smaller site

Show in viewer

Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #9

0.632

Likely same site as P2Rank 1 5.3 Å 24 shared residues 96% of smaller site

Show in viewer

Surrounding area

Pocket 2 FPocket #2

0.301 Unusual size

Likely same site as P2Rank 1 7.2 Å 27 shared residues 75% of smaller site

Show in viewer

Surrounding area

All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold DB AF_A0A0H3GS18	AlphaFold DB	—	—	full sequence	—	Viewing
ColabFold VK055_1076	ColabFold	—	—	full sequence	—	Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

59 records

Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records

Transferred evidence 9 records from similar proteins

Structural ligands 9 0 loaded crystals

Measured bioactivity 0 direct and transferred ChEMBL records

Proposed compounds 50 similarity-based ZINC candidates

Best available ligand signal

1XX PDB via homolog 128.1 Da · LogP 0.76 · TPSA 46.5 Open detail RCSB PDB

2XX PDB via homolog Detail RCSB PDB

3XX PDB via homolog Detail RCSB PDB

4XX PDB via homolog Detail RCSB PDB

8ID PDB via homolog Detail RCSB PDB

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.

No PDB structure with a co-crystallized ligand found for this exact protein.

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Ligand	Source crystal	UniProt (homolog)	MW · LogP · TPSA	Lipinski	PAINS	SMILES
1XX RCSB PDB	4IDC	O23939	128.1 Da LogP 0.76 TPSA 46.5	✓ Ro5	✓ Clean	`C[C@@H]1C(=O)C(=C(O1)C)O`
2XX RCSB PDB	4IDD	O23939	142.2 Da LogP 1.15 TPSA 46.5	✓ Ro5	✓ Clean	`CC[C@@H]1C(=O)C(=C(O1)C)O`
3XX RCSB PDB	4IDE	O23939	140.1 Da LogP 1.28 TPSA 46.5	✓ Ro5	✓ Clean	`C/C=C/1\C(=O)C(=C(O1)C)O`
4XX RCSB PDB	4IDF	O23939	114.1 Da LogP 0.38 TPSA 46.5	✓ Ro5	✓ Clean	`CC1=C(C(=O)CO1)O`
8ID RCSB PDB	4W6Z	P00330	790.3 Da LogP -2.41 TPSA 318.3	3 viol.	✓ Clean	`c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO[P…`
BMD RCSB PDB	3PII	P42328	87.1 Da LogP 0.27 TPSA 43.1	✓ Ro5	✓ Clean	`CCCC(=O)N`
CO7 RCSB PDB	3B6Z	Q9Y7D0	835.6 Da LogP -0.76 TPSA 363.6	3 viol.	✓ Clean	`C/C=C/C(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P@…`
ETF RCSB PDB	4W6Z	P00330	100.0 Da LogP 0.54 TPSA 20.2	✓ Ro5	✓ Clean	`C(C(F)(F)F)O`
KZH RCSB PDB	5A3J	Q9SV68	292.4 Da LogP 4.84 TPSA 54.4	✓ Ro5	✓ Clean	`CCC=CCC(=O)C=CC=CCCCCCCCC(=O)O`

Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL bioactivity data found for this exact protein.

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL hits found through similar proteins.

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Ligand	Tanimoto	MW · LogP · TPSA	Lipinski	PAINS	SMILES
ZINC71404741 ZINC	0.641	292.4 Da LogP 4.84 TPSA 54.4	✓ Ro5	✓ Clean	`CC/C=C\C/C=C\C=C\C(=O)CCCCCCCC(=O)O`
ZINC1775964273 ZINC	0.639	224.3 Da LogP 3.11 TPSA 54.4	✓ Ro5	✓ Clean	`CC(=O)/C=C/C=C/CCCCCCC(=O)O`
ZINC1693895 ZINC	0.632	227.4 Da LogP 4.17 TPSA 43.1	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCC(N)=O`
ZINC2170606 ZINC	0.632	213.4 Da LogP 3.78 TPSA 43.1	✓ Ro5	✓ Clean	`CCCCCCCCCCCCC(N)=O`
ZINC86040350 ZINC	0.632	241.4 Da LogP 4.56 TPSA 43.1	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCC(N)=O`
ZINC8689949 ZINC	0.632	255.4 Da LogP 4.95 TPSA 43.1	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCCC(N)=O`
ZINC2297732054 ZINC	0.595	294.4 Da LogP 4.63 TPSA 57.5	✓ Ro5	✓ Clean	`CCC=CC[C@H](O)C=CC=CCCCCCCCC(=O)O`
ZINC2333257289 ZINC	0.595	294.4 Da LogP 4.63 TPSA 57.5	✓ Ro5	✓ Clean	`CCC=CC[C@@H](O)C=CC=CCCCCCCCC(=O)O`
ZINC34961834 ZINC	0.595	294.4 Da LogP 4.63 TPSA 57.5	✓ Ro5	✓ Clean	`CC/C=C\C[C@H](O)/C=C/C=C\CCCCCCCC(=O)O`
ZINC83314730 ZINC	0.595	266.4 Da LogP 3.85 TPSA 57.5	✓ Ro5	✓ Clean	`CC/C=C\C[C@H](O)/C=C/C=C\CCCCCC(=O)O`
ZINC33822120 ZINC	0.595	250.4 Da LogP 4.88 TPSA 37.3	✓ Ro5	✓ Clean	`CC/C=C\C/C=C\C/C=C\CCCCCC(=O)O`
ZINC65742970 ZINC	0.575	310.4 Da LogP 4.04 TPSA 74.6	✓ Ro5	✓ Clean	`O=C(O)CCCC(=O)/C=C/C=C\CCCCCCCCCO`
ZINC117698057 ZINC	0.558	310.4 Da LogP 4.03 TPSA 74.6	✓ Ro5	✓ Clean	`CC/C=C\C[C@H](O)C(=O)C/C=C\CCCCCCCC(=O)O`
ZINC43898792 ZINC	0.553	334.5 Da LogP 4.37 TPSA 74.6	✓ Ro5	✓ Clean	`CCCCC/C=C\CC(=O)/C=C\C=C/C=C/[C@@H](O)CCCC(=O)O`
ZINC4632131 ZINC	0.553	334.5 Da LogP 4.37 TPSA 74.6	✓ Ro5	✓ Clean	`CCCCC/C=C\CC(=O)/C=C/C=C/C=C\[C@@H](O)CCCC(=O)O`
ZINC12503278 ZINC	0.548	335.2 Da LogP -2.20 TPSA 163.4	✓ Ro5	✓ Clean	`NC(=O)c1ccc[n+]([C@@H]2O[C@H](COP(=O)(O)O)[C@@H…`
ZINC1532667 ZINC	0.548	335.2 Da LogP -2.20 TPSA 163.4	✓ Ro5	✓ Clean	`NC(=O)c1ccc[n+]([C@H]2O[C@@H](COP(=O)(O)O)[C@H]…`
ZINC2545161 ZINC	0.548	335.2 Da LogP -2.20 TPSA 163.4	✓ Ro5	✓ Clean	`NC(=O)c1ccc[n+]([C@@H]2O[C@@H](COP(=O)(O)O)[C@H…`
ZINC3870109 ZINC	0.548	335.2 Da LogP -2.20 TPSA 163.4	✓ Ro5	✓ Clean	`NC(=O)c1ccc[n+]([C@@H]2O[C@@H](COP(=O)(O)O)[C@@…`
ZINC40465856 ZINC	0.548	335.2 Da LogP -2.20 TPSA 163.4	✓ Ro5	✓ Clean	`NC(=O)c1ccc[n+]([C@@H]2O[C@H](COP(=O)(O)O)[C@H]…`
ZINC40762833 ZINC	0.548	335.2 Da LogP -2.20 TPSA 163.4	✓ Ro5	✓ Clean	`NC(=O)c1ccc[n+]([C@H]2O[C@H](COP(=O)(O)O)[C@@H]…`
ZINC4228273 ZINC	0.548	335.2 Da LogP -2.20 TPSA 163.4	✓ Ro5	✓ Clean	`NC(=O)c1ccc[n+]([C@@H]2O[C@H](COP(=O)(O)O)[C@@H…`
ZINC77311638 ZINC	0.548	335.2 Da LogP -2.20 TPSA 163.4	✓ Ro5	✓ Clean	`NC(=O)c1ccc[n+]([C@@H]2O[C@H](COP(=O)(O)O)[C@H]…`
ZINC104393063 ZINC	0.545	297.5 Da LogP 4.91 TPSA 60.2	✓ Ro5	✓ Clean	`CCCCCCCC(=O)CCCCCCCCCC(N)=O`
ZINC100104443 ZINC	0.543	282.4 Da LogP 4.35 TPSA 66.8	✓ Ro5	✓ Clean	`CC/C=C\C[C@@H](/C=C/C=C\CCCCCC(=O)O)OO`
ZINC3871401 ZINC	0.533	427.2 Da LogP -1.75 TPSA 232.6	2 viol.	✓ Clean	`Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…`
ZINC3871402 ZINC	0.533	427.2 Da LogP -1.75 TPSA 232.6	2 viol.	✓ Clean	`Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…`
ZINC3871403 ZINC	0.533	427.2 Da LogP -1.75 TPSA 232.6	2 viol.	✓ Clean	`Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…`
ZINC3871404 ZINC	0.533	427.2 Da LogP -1.75 TPSA 232.6	2 viol.	✓ Clean	`Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…`
ZINC4096223 ZINC	0.533	427.2 Da LogP -1.75 TPSA 232.6	2 viol.	✓ Clean	`Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…`
ZINC116475206 ZINC	0.529	284.4 Da LogP 3.42 TPSA 86.2	✓ Ro5	✓ Clean	`NC(=O)CCCCCCCCCCCCCCC(N)=O`
ZINC1587906 ZINC	0.529	200.3 Da LogP 1.08 TPSA 86.2	✓ Ro5	✓ Clean	`NC(=O)CCCCCCCCC(N)=O`
ZINC71771467 ZINC	0.529	256.4 Da LogP 2.64 TPSA 86.2	✓ Ro5	✓ Clean	`NC(=O)CCCCCCCCCCCCC(N)=O`
ZINC31159201 ZINC	0.528	228.3 Da LogP 2.83 TPSA 74.6	✓ Ro5	✓ Clean	`O=C(O)C/C=C\CCCCCCCC(=O)O`
ZINC1531062 ZINC	0.514	226.4 Da LogP 4.55 TPSA 37.3	✓ Ro5	✓ Clean	`CCCC/C=C/CCCCCCCC(=O)O`
ZINC2504617 ZINC	0.514	240.4 Da LogP 4.94 TPSA 37.3	✓ Ro5	✓ Clean	`CCCC/C=C/CCCCCCCCC(=O)O`
ZINC4529321 ZINC	0.514	226.4 Da LogP 4.55 TPSA 37.3	✓ Ro5	✓ Clean	`CCCC/C=C\CCCCCCCC(=O)O`
ZINC5260769 ZINC	0.514	240.4 Da LogP 4.94 TPSA 37.3	✓ Ro5	✓ Clean	`CCCC/C=C\CCCCCCCCC(=O)O`
ZINC64633397 ZINC	0.514	226.4 Da LogP 4.55 TPSA 37.3	✓ Ro5	✓ Clean	`CCCCCC/C=C\CCCCCC(=O)O`
ZINC15121776 ZINC	0.513	306.4 Da LogP 4.02 TPSA 71.4	✓ Ro5	✓ Clean	`CCC(=O)/C=C/C=C/C=C/C(=O)CCCCCCCC(=O)O`
ZINC238950253 ZINC	0.505	744.4 Da LogP -2.90 TPSA 364.8	3 viol.	✓ Clean	`NC(=O)c1ccc[n+]([C@@H]2O[C@H](CO[P@](=O)(O)O[P@…`
ZINC238950256 ZINC	0.505	744.4 Da LogP -2.90 TPSA 364.8	3 viol.	✓ Clean	`NC(=O)c1ccc[n+]([C@@H]2O[C@H](CO[P@](=O)(O)O[P@…`
ZINC238950259 ZINC	0.505	744.4 Da LogP -2.90 TPSA 364.8	3 viol.	✓ Clean	`NC(=O)c1ccc[n+]([C@@H]2O[C@H](CO[P@](=O)(O)O[P@…`
ZINC238950261 ZINC	0.505	744.4 Da LogP -2.90 TPSA 364.8	3 viol.	✓ Clean	`NC(=O)c1ccc[n+]([C@@H]2O[C@H](CO[P@](=O)(O)O[P@…`
ZINC1652036 ZINC	0.500	212.1 Da LogP 0.88 TPSA 40.5	✓ Ro5	✓ Clean	`OCC(F)(F)C(F)(F)C(F)(F)CO`
ZINC167857731 ZINC	0.500	393.1 Da LogP -1.38 TPSA 139.5	✓ Ro5	✓ Clean	`Nc1ncnc2c1nc(I)n2[C@@H]1O[C@H](CO)[C@@H](O)[C@@…`
ZINC167857829 ZINC	0.500	393.1 Da LogP -1.38 TPSA 139.5	✓ Ro5	✓ Clean	`Nc1ncnc2c1nc(I)n2[C@@H]1O[C@H](CO)[C@H](O)[C@@H…`
ZINC167857942 ZINC	0.500	393.1 Da LogP -1.38 TPSA 139.5	✓ Ro5	✓ Clean	`Nc1ncnc2c1nc(I)n2[C@@H]1O[C@H](CO)[C@H](O)[C@H]…`
ZINC2170208 ZINC	0.500	262.1 Da LogP 1.51 TPSA 40.5	✓ Ro5	✓ Clean	`OCC(F)(F)C(F)(F)C(F)(F)C(F)(F)CO`
ZINC79883150 ZINC	0.500	250.1 Da LogP 2.65 TPSA 20.2	✓ Ro5	✓ Clean	`OCC(C(F)(F)F)(C(F)(F)F)C(F)(F)F`

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GS18