KpATCC43816 Protein target profile

putative oxidoreductase with NAD(P)-binding Rossmann-fold domain

Accession: VK055_1087

Gene: AIK79710.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GMD8
Length 237
Pocket druggability (P2Rank · AlphaFold DB model) 0.889
Direct ligand evidence 0 63 total records
Functional annotation 0 EC 0 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
34.653 Lower values reduce human off-target concern.
Human E-value
4.72e-08
Gut microbiome similarity
0.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
37.349 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
97.34 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.889
Structure A0A0H3GMD8
Pocket Pocket 1
Druggability (FPocket) 0.711
Structure A0A0H3GMD8
Pocket Pocket 1
ColabFold model
P2Rank 0.878 · Pocket 1
FPocket 0.66 · Pocket 1
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 19 / 4744 genomes with a hit
Prevalence 0.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MTAFHNKSVLVLGGSRGIGAAIVRRFVADGASVVFSYSGSPEAAERLAAETGSTAVQADSADRDGVISLVRDSGPLDVLVVNAGIALFGDALEQDSDAIDRLFRINIHSPYHASVEAARRMPEGGRIIVIGSVNGDRMPVPGMAAYALSKSALQGLARGLARDFGPRGITVNVVQPGPIDTDANPENGPMKELMHNFMAIKRHGRPEEVAGMVAWLAGPEASFVTGAMHTIDGAFGA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

Subcellular localization

Localization
Cytoplasmic

No GO or EC annotations are currently loaded for this protein.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

24 records
Show feature table
Start End DB Term Name
15 233 Pfam PF13561 Enoyl-(Acyl carrier protein) reductase
74 85 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
74 85 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
167 184 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
167 184 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
8 25 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
8 25 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
146 165 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
146 165 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
119 135 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
119 135 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
199 219 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
199 219 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
7 182 SMART SM00822 This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
146 165 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
125 133 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
125 133 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
74 85 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
1 236 FunFam G3DSA:3.40.50.720:FF:000290 SDR family oxidoreductase
9 232 CDD cd05233 SDR_c
1 236 Gene3D G3DSA:3.40.50.720 -
2 234 PANTHER PTHR43943 DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 4
6 234 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
6 234 InterPro IPR036291 NAD(P)-binding domain superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.889
Likely same site as FPocket 1 2.7 Å 26 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.385
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.711 Unusual size
Likely same site as P2Rank 1 2.7 Å 26 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GMD8
AlphaFold DB full sequence Viewing
ColabFold VK055_1087
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

63 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 13 records from similar proteins
Structural ligands 12 0 loaded crystals
Measured bioactivity 1 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
BEA PDB via homolog 190.3 Da · LogP 1.67 · TPSA 31.4 Open detail RCSB PDB
CUE PDB via homolog Detail RCSB PDB
GEN PDB via homolog Detail RCSB PDB
HHF PDB via homolog Detail RCSB PDB
KMP PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
BEA RCSB PDB Q12634 190.3 Da LogP 1.67 TPSA 31.4 ✓ Ro5 ✓ Clean Cc1cccc2c1n3cn[nH+]c3s2
CUE RCSB PDB O93874 268.2 Da LogP 3.10 TPSA 83.8 ✓ Ro5 ✓ Clean c1cc2c(cc1O)oc-3c2C(=O)Oc4c3ccc(c4)O
GEN RCSB PDB O93874 270.2 Da LogP 2.58 TPSA 90.9 ✓ Ro5 ✓ Clean c1cc(ccc1C2=COc3cc(cc(c3C2=O)O)O)O
HHF RCSB PDB O93874 254.2 Da LogP 2.87 TPSA 70.7 ✓ Ro5 ✓ Clean c1ccc(cc1)C2=C(C(=O)c3ccc(cc3O2)O)O
KMP RCSB PDB O93874 286.2 Da LogP 2.28 TPSA 111.1 ✓ Ro5 ✓ Clean c1cc(ccc1C2=C(C(=O)c3c(cc(cc3O2)O)O)O)O
MLH RCSB PDB V5VHN7 417.3 Da LogP 4.34 TPSA 54.7 ✓ Ro5 ✓ Clean CCOC(=O)c1c2cc(c(cc2n(c1CN(C)C)c3ccccc3)Br)O
NID RCSB PDB Q12634 175.1 Da LogP 1.80 TPSA 60.2 ✓ Ro5 ✓ Clean c1cc2c(c(c1)[N+](=O)[O-])C=CC2=O
PG0 RCSB PDB P39333 120.1 Da LogP -0.36 TPSA 38.7 ✓ Ro5 ✓ Clean COCCOCCO
PHH RCSB PDB Q12634 271.9 Da LogP 3.97 TPSA 26.3 ✓ Ro5 ✓ Clean C1c2c(c(c(c(c2Cl)Cl)Cl)Cl)C(=O)O1
PYQ RCSB PDB Q12634 173.2 Da LogP 1.52 TPSA 20.3 ✓ Ro5 ✓ Clean c1cc2c3c(c1)CCN3C(=O)CC2
QSO RCSB PDB O93874 284.3 Da LogP 2.88 TPSA 79.9 ✓ Ro5 ✓ Clean COc1ccc(cc1)C2=COc3cc(cc(c3C2=O)O)O
RM4 RCSB PDB C1DMX5 164.2 Da LogP -2.19 TPSA 90.2 ✓ Ro5 ✓ Clean C[C@H]1[C@@H]([C@H]([C@H]([C@H](O1)O)O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.