KpATCC43816 Protein target profile

opgC family protein

Accession: VK055_1117

Gene: AIK79740.1 3D evidence: ColabFold model Metabolism Not in network
Export view
Length 340
Pocket druggability (P2Rank · ColabFold model) 0.952
Functional annotation 0 EC 0 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Second pocket predictor agrees P2Rank predicted binding-site probability 0.95. Structure available ColabFold model

Risks to review

Microbiome similarity 22 of 4744 screened genomes (0.5%) have a significant similarity hit. This target also has a predicted binding pocket (P2Rank 0.95) — check the ligand evidence before deprioritizing on off-target risk alone. Mixed conservation Core/accessory calls are not fully concordant. Best pocket may be a modeling artifact FPocket selected-pocket score 0.90, but this pocket's geometry is unusually large/diffuse compared to this protein's other predicted pockets — may reflect a low-confidence or disordered model region rather than a real cavity.

Evidence gaps

No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
86.19 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

ColabFold / curated model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.952
Structure CB_VK055_1117
Pocket Pocket 1
Druggability (FPocket) 0.897
Structure CB_VK055_1117
Pocket Pocket 30
ColabFold model
P2Rank 0.952 · Pocket 1
FPocket 0.897 · Pocket 30
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 22 / 4744 genomes with a hit
Prevalence 0.5%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSQVASAISQKETYKSMSWRYSLAGERDLRIDFMRGIALVMMVVAHTEVMSIFNIFSWERFGLTTGAEGFVILSGFMLGMLNRTRLQKAVLLTVGWGLYLRAWKIYQVNIIIIVTFLLLRYFPFINAFEVTHFTDRFSGTSWSLYPLTPQIKETWFNIILYLQIGPHQTQILGLYIFLLLLSPLFLGMLQKGHVYPLLGVSLLIYGCWQRWPVRVTPCEFEFAFPLLAWQFIFVLGMCCGWYKAELISFARTPPGKVAVVALVFIALILAFVAQNHTNPFMPPALLMHVIPPAEFNAFYHTWAAKNGLGPVRILNDISLMVTIYLLLTWCWRPLNWLAGS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

Subcellular localization

Localization
CytoplasmicMembrane

No GO or EC annotations are currently loaded for this protein.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

29 records
Show feature table
Start End DB Term Name
317 339 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 36 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
313 331 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
82 101 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
25 336 PANTHER PTHR38592 BLL4819 PROTEIN
25 336 InterPro IPR014550 Uncharacterised conserved protein UCP028704, OpgC
27 336 Pfam PF10129 OpgC protein
27 336 InterPro IPR014550 Uncharacterised conserved protein UCP028704, OpgC
212 222 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
243 253 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
123 170 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
171 189 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
62 81 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
193 212 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
332 340 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
223 242 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
164 186 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
190 193 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
36 58 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
257 274 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
37 56 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
102 122 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
102 124 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
57 61 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
194 211 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
254 273 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
274 312 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
62 81 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
222 244 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.952
Likely same site as FPocket 18 5.7 Å 17 shared residues 89% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.912
Likely same site as FPocket 30 2.1 Å 19 shared residues 95% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.688
Likely same site as FPocket 2 1.1 Å 17 shared residues 94% of smaller site
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.192
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.074
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #30
0.897 Unusual size
Likely same site as P2Rank 2 2.1 Å 19 shared residues 95% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #18
0.244
Likely same site as P2Rank 1 5.7 Å 17 shared residues 89% of smaller site
Show in viewer
Surrounding area
Pocket 3 FPocket #2
0.222
Likely same site as P2Rank 3 1.1 Å 17 shared residues 94% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 1 predicted

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
ColabFold VK055_1117
ColabFold — — full sequence — Viewing