KpATCC43816 Protein target profile

L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme L-Ala-D/L-Glu epimerase

Accession: VK055_1138

Gene: AIK79762.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GNH7
Length 321
Pocket druggability (P2Rank · AlphaFold DB model) 0.865
Direct ligand evidence 0 54 total records
Functional annotation 1 EC 3 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
27.616 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
97.96 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.865
Structure A0A0H3GNH7
Pocket Pocket 1
Druggability (FPocket) 0.931
Structure A0A0H3GNH7
Pocket Pocket 1
ColabFold model
P2Rank 0.742 · Pocket 1
FPocket 0.87 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 90 / 4744 genomes with a hit
Prevalence 1.9%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MRNVRVYEEAWPLHTPFVIARGSRSEAKVVVVELEEDGVKGVGECTPYPRYGESIASVMAQVMAIGEQLEAGLTREQLQRLLPAGAARNAIDCALWDLQARREGKTLAQLLGVALPNRVITAQTVVIGTPDQMAASAAALWQAGAQLLKVKLDDRLISERLIAIRQAAPEATLIVDANESWHSEGLAARCQLLADLGVAMLEQPLPADDDSALENFVHPLPICADESCHTRESLPRLRGRYEMINIKLDKTGGLTEALALAGEAERQEFERMLGCMLCTSRGIAAALPLAPLARFADLDGPTWLAVDVEPALRFSTGVLHL

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 3 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

3
  • GO:0009063 The chemical reactions and pathways resulting in the breakdown of amino acids, organic acids containing one or more amino substituents.
  • GO:0016855 Catalysis of a reaction that alters the configuration of one or more chiral centers in an amino acid.
  • GO:0046872 Binding to a metal ion.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

24 records
Show feature table
Start End DB Term Name
115 321 Gene3D G3DSA:3.20.20.120 -
115 321 InterPro IPR036849 Enolase-like, C-terminal domain superfamily
1 103 FunFam G3DSA:3.30.390.10:FF:000010 Dipeptide epimerase
2 112 Pfam PF02746 Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
2 112 InterPro IPR013341 Mandelate racemase/muconate lactonizing enzyme, N-terminal domain
19 317 PANTHER PTHR48080 D-GALACTONATE DEHYDRATASE-RELATED
19 317 InterPro IPR034593 D-galactonate dehydratase DgoD-like
10 321 SFLD SFLDF00010 dipeptide epimerase
10 321 InterPro IPR034603 Dipeptide epimerase
130 223 SMART SM00922 MR_MLE_2
130 223 InterPro IPR013342 Mandelate racemase/muconate lactonizing enzyme, C-terminal
3 304 CDD cd03319 L-Ala-DL-Glu_epimerase
3 304 InterPro IPR034603 Dipeptide epimerase
1 104 Gene3D G3DSA:3.30.390.10 -
1 104 InterPro IPR029017 Enolase-like, N-terminal
133 319 Pfam PF13378 Enolase C-terminal domain-like
133 319 InterPro IPR029065 Enolase C-terminal domain-like
173 204 ProSitePatterns PS00909 Mandelate racemase / muconate lactonizing enzyme family signature 2.
173 204 InterPro IPR018110 Mandelate racemase/muconate lactonizing enzyme, conserved site
116 318 SUPERFAMILY SSF51604 Enolase C-terminal domain-like
116 318 InterPro IPR036849 Enolase-like, C-terminal domain superfamily
10 321 SFLD SFLDS00001 Enolase
2 112 SUPERFAMILY SSF54826 Enolase N-terminal domain-like
2 112 InterPro IPR029017 Enolase-like, N-terminal

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.865
Likely same site as FPocket 1 2.4 Å 17 shared residues 89% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.185
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.052
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.931
Likely same site as P2Rank 1 2.4 Å 17 shared residues 89% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:151-151 Proton acceptor; specific for (R)-substrate epimerization
UniProt: Active site:247-247 Proton acceptor; specific for (S)-substrate epimerization
UniProt: Binding site:176-176
UniProt: Binding site:202-202
UniProt: Binding site:225-225
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GNH7
AlphaFold DB full sequence Viewing
ColabFold VK055_1138
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

54 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 4 records from similar proteins
Structural ligands 4 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
FUM PDB via homolog 116.1 Da · LogP -0.29 · TPSA 74.6 Open detail RCSB PDB
NSK PDB via homolog Detail RCSB PDB
SUG PDB via homolog Detail RCSB PDB
TAR PDB via homolog Detail RCSB PDB
ZINC1866114950 ZINC proposed compound · Tanimoto 0.844 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
FUM RCSB PDB B0TZW0 116.1 Da LogP -0.29 TPSA 74.6 ✓ Ro5 ✓ Clean C(=C/C(=O)O)\C(=O)O
NSK RCSB PDB Q81IL5 246.3 Da LogP -0.45 TPSA 129.7 ✓ Ro5 ✓ Clean C(CCN)C[C@@H](C(=O)O)NC(=O)CCC(=O)O
SUG RCSB PDB Q81IL5 274.3 Da LogP -1.32 TPSA 165.6 1 viol. ✓ Clean C(C[C@@H](C(=O)O)NC(=O)CCC(=O)O)CNC(=N)N
TAR RCSB PDB B0TZW0 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@H]([C@@H](C(=O)O)O)(C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.