KpATCC43816 Protein target profile
L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme L-Ala-D/L-Glu epimerase
Accession: VK055_1138
Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 1.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 27.616 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 97.96 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MRNVRVYEEAWPLHTPFVIARGSRSEAKVVVVELEEDGVKGVGECTPYPRYGESIASVMAQVMAIGEQLEAGLTREQLQRLLPAGAARNAIDCALWDLQARREGKTLAQLLGVALPNRVITAQTVVIGTPDQMAASAAALWQAGAQLLKVKLDDRLISERLIAIRQAAPEATLIVDANESWHSEGLAARCQLLADLGVAMLEQPLPADDDSALENFVHPLPICADESCHTRESLPRLRGRYEMINIKLDKTGGLTEALALAGEAERQEFERMLGCMLCTSRGIAAALPLAPLARFADLDGPTWLAVDVEPALRFSTGVLHL
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
3- GO:0009063 The chemical reactions and pathways resulting in the breakdown of amino acids, organic acids containing one or more amino substituents.
- GO:0016855 Catalysis of a reaction that alters the configuration of one or more chiral centers in an amino acid.
- GO:0046872 Binding to a metal ion.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 115 | 321 | Gene3D | G3DSA:3.20.20.120 | - |
| 115 | 321 | InterPro | IPR036849 | Enolase-like, C-terminal domain superfamily |
| 1 | 103 | FunFam | G3DSA:3.30.390.10:FF:000010 | Dipeptide epimerase |
| 2 | 112 | Pfam | PF02746 | Mandelate racemase / muconate lactonizing enzyme, N-terminal domain |
| 2 | 112 | InterPro | IPR013341 | Mandelate racemase/muconate lactonizing enzyme, N-terminal domain |
| 19 | 317 | PANTHER | PTHR48080 | D-GALACTONATE DEHYDRATASE-RELATED |
| 19 | 317 | InterPro | IPR034593 | D-galactonate dehydratase DgoD-like |
| 10 | 321 | SFLD | SFLDF00010 | dipeptide epimerase |
| 10 | 321 | InterPro | IPR034603 | Dipeptide epimerase |
| 130 | 223 | SMART | SM00922 | MR_MLE_2 |
| 130 | 223 | InterPro | IPR013342 | Mandelate racemase/muconate lactonizing enzyme, C-terminal |
| 3 | 304 | CDD | cd03319 | L-Ala-DL-Glu_epimerase |
| 3 | 304 | InterPro | IPR034603 | Dipeptide epimerase |
| 1 | 104 | Gene3D | G3DSA:3.30.390.10 | - |
| 1 | 104 | InterPro | IPR029017 | Enolase-like, N-terminal |
| 133 | 319 | Pfam | PF13378 | Enolase C-terminal domain-like |
| 133 | 319 | InterPro | IPR029065 | Enolase C-terminal domain-like |
| 173 | 204 | ProSitePatterns | PS00909 | Mandelate racemase / muconate lactonizing enzyme family signature 2. |
| 173 | 204 | InterPro | IPR018110 | Mandelate racemase/muconate lactonizing enzyme, conserved site |
| 116 | 318 | SUPERFAMILY | SSF51604 | Enolase C-terminal domain-like |
| 116 | 318 | InterPro | IPR036849 | Enolase-like, C-terminal domain superfamily |
| 10 | 321 | SFLD | SFLDS00001 | Enolase |
| 2 | 112 | SUPERFAMILY | SSF54826 | Enolase N-terminal domain-like |
| 2 | 112 | InterPro | IPR029017 | Enolase-like, N-terminal |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GNH7
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_1138
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| FUM RCSB PDB | B0TZW0 | 116.1 Da LogP -0.29 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(=C/C(=O)O)\C(=O)O
|
|
| NSK RCSB PDB | Q81IL5 | 246.3 Da LogP -0.45 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C(CCN)C[C@@H](C(=O)O)NC(=O)CCC(=O)O
|
|
| SUG RCSB PDB | Q81IL5 | 274.3 Da LogP -1.32 TPSA 165.6 | 1 viol. | ✓ Clean |
C(C[C@@H](C(=O)O)NC(=O)CCC(=O)O)CNC(=N)N
|
|
| TAR RCSB PDB | B0TZW0 | 150.1 Da LogP -2.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
[C@H]([C@@H](C(=O)O)O)(C(=O)O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1866114950 ZINC | 0.844 | 260.3 Da LogP -0.06 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
NCCCC[C@H](NC(=O)CCCC(=O)O)C(=O)O
|
| ZINC1530138 ZINC | 0.806 | 217.3 Da LogP -0.97 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
NCCCC[C@H](NC(=O)CCN)C(=O)O
|
| ZINC403598 ZINC | 0.800 | 273.3 Da LogP 2.14 TPSA 92.8 | ✓ Ro5 | ✓ Clean |
N[C@@H](Cc1ccc(Oc2ccc(O)cc2)cc1)C(=O)O
|
| ZINC403599 ZINC | 0.800 | 273.3 Da LogP 2.14 TPSA 92.8 | ✓ Ro5 | ✓ Clean |
N[C@H](Cc1ccc(Oc2ccc(O)cc2)cc1)C(=O)O
|
| ZINC15261332 ZINC | 0.744 | 303.3 Da LogP -1.99 TPSA 191.6 | 1 viol. | ✓ Clean |
N=C(N)NCCC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC39351856 ZINC | 0.741 | 328.4 Da LogP 1.26 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](Cc1ccc(-c2ccc(C[C@H](N)C(=O)O)cc2)cc1)C…
|
| ZINC1576211 ZINC | 0.730 | 231.3 Da LogP -2.22 TPSA 154.3 | 1 viol. | ✓ Clean |
N=C(N)NCCC[C@H](NC(=O)CN)C(=O)O
|
| ZINC116981435 ZINC | 0.706 | 319.3 Da LogP -0.81 TPSA 179.0 | 1 viol. | ✓ Clean |
NCCCC[C@@H](NC(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC116981437 ZINC | 0.706 | 319.3 Da LogP -0.81 TPSA 179.0 | 1 viol. | ✓ Clean |
NCCCC[C@@H](NC(=O)N[C@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC116981440 ZINC | 0.706 | 319.3 Da LogP -0.81 TPSA 179.0 | 1 viol. | ✓ Clean |
NCCCC[C@H](NC(=O)N[C@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC40860752 ZINC | 0.706 | 319.3 Da LogP -0.81 TPSA 179.0 | 1 viol. | ✓ Clean |
NCCCC[C@H](NC(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC1847640 ZINC | 0.703 | 216.2 Da LogP -1.16 TPSA 128.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H](CCCNC(=N)N)C(=O)O
|
| ZINC2169795 ZINC | 0.703 | 216.2 Da LogP -1.16 TPSA 128.3 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H](CCCNC(=N)N)C(=O)O
|
| ZINC1722125 ZINC | 0.694 | 217.2 Da LogP -1.63 TPSA 154.3 | 1 viol. | ✓ Clean |
N=C(N)NCCC[C@H](NC(N)=O)C(=O)O
|
| ZINC4537126 ZINC | 0.694 | 217.2 Da LogP -1.63 TPSA 154.3 | 1 viol. | ✓ Clean |
N=C(N)NCCC[C@@H](NC(N)=O)C(=O)O
|
| ZINC12359024 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC13533920 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC1532740 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC1549593 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC2013424 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC3581021 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC3860635 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC5783661 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC6072527 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC32333 ZINC | 0.690 | 244.1 Da LogP 1.40 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
N[C@@H](Cc1ccc(Br)cc1)C(=O)O
|
| ZINC32334 ZINC | 0.690 | 244.1 Da LogP 1.40 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
N[C@H](Cc1ccc(Br)cc1)C(=O)O
|
| ZINC3679925 ZINC | 0.690 | 291.1 Da LogP 1.25 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
N[C@H](Cc1ccc(I)cc1)C(=O)O
|
| ZINC391104 ZINC | 0.690 | 291.1 Da LogP 1.25 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
N[C@@H](Cc1ccc(I)cc1)C(=O)O
|
| ZINC4202286 ZINC | 0.690 | 209.2 Da LogP 0.34 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](Cc1ccc(C(=O)O)cc1)C(=O)O
|
| ZINC4202287 ZINC | 0.690 | 209.2 Da LogP 0.34 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
N[C@H](Cc1ccc(C(=O)O)cc1)C(=O)O
|
| ZINC6092920 ZINC | 0.690 | 223.2 Da LogP 0.27 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](Cc1ccc(CC(=O)O)cc1)C(=O)O
|
| ZINC6506146 ZINC | 0.690 | 223.2 Da LogP 0.27 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
N[C@H](Cc1ccc(CC(=O)O)cc1)C(=O)O
|
| ZINC34319489 ZINC | 0.688 | 231.3 Da LogP 1.50 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
N[C@@H](Cc1ccc2cc(O)ccc2c1)C(=O)O
|
| ZINC34319490 ZINC | 0.688 | 231.3 Da LogP 1.50 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
N[C@H](Cc1ccc2cc(O)ccc2c1)C(=O)O
|
| ZINC1529261 ZINC | 0.684 | 304.3 Da LogP -1.39 TPSA 185.8 | 1 viol. | ✓ Clean |
N=C(N)NCCC[C@@H](N[C@@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC1529262 ZINC | 0.684 | 304.3 Da LogP -1.39 TPSA 185.8 | 1 viol. | ✓ Clean |
N=C(N)NCCC[C@@H](N[C@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC1529939 ZINC | 0.684 | 304.3 Da LogP -1.39 TPSA 185.8 | 1 viol. | ✓ Clean |
N=C(N)NCCC[C@H](N[C@@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC1529940 ZINC | 0.684 | 304.3 Da LogP -1.39 TPSA 185.8 | 1 viol. | ✓ Clean |
N=C(N)NCCC[C@H](N[C@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC1530510 ZINC | 0.684 | 246.3 Da LogP -1.23 TPSA 148.5 | 1 viol. | ✓ Clean |
N=C(N)NCCC[C@H](NCCC(=O)O)C(=O)O
|
| ZINC1530296 ZINC | 0.677 | 247.2 Da LogP -0.71 TPSA 141.0 | ✓ Ro5 | ✓ Clean |
O=C(O)CCC(=O)N[C@@H](CCC(=O)O)C(=O)O
|
| ZINC2512061 ZINC | 0.677 | 360.4 Da LogP 0.67 TPSA 167.1 | 1 viol. | ✓ Clean |
N[C@@H](Cc1ccc(O)c(-c2cc(C[C@H](N)C(=O)O)ccc2O)…
|
| ZINC6091882 ZINC | 0.677 | 360.4 Da LogP 0.67 TPSA 167.1 | 1 viol. | ✓ Clean |
N[C@@H](Cc1ccc(O)c(-c2cc(C[C@@H](N)C(=O)O)ccc2O…
|
| ZINC6091894 ZINC | 0.677 | 360.4 Da LogP 0.67 TPSA 167.1 | 1 viol. | ✓ Clean |
N[C@H](Cc1ccc(O)c(-c2cc(C[C@@H](N)C(=O)O)ccc2O)…
|
| ZINC6783254 ZINC | 0.676 | 231.2 Da LogP 0.61 TPSA 103.7 | ✓ Ro5 | ✓ Clean |
CCCC[C@H](NC(=O)CCC(=O)O)C(=O)O
|
| ZINC6783285 ZINC | 0.676 | 231.2 Da LogP 0.61 TPSA 103.7 | ✓ Ro5 | ✓ Clean |
CCCC[C@@H](NC(=O)CCC(=O)O)C(=O)O
|
| ZINC113625226 ZINC | 0.676 | 272.4 Da LogP 2.05 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)N[C@@H](CCCCN)C(=O)O
|
| ZINC28539131 ZINC | 0.676 | 328.5 Da LogP 3.61 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)N[C@@H](CCCCN)C(=O)O
|
| ZINC14982778 ZINC | 0.667 | 207.2 Da LogP 0.84 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(C[C@@H](N)C(=O)O)cc1
|
| ZINC14982780 ZINC | 0.667 | 207.2 Da LogP 0.84 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(C[C@H](N)C(=O)O)cc1
|
| ZINC2575618 ZINC | 0.667 | 208.2 Da LogP -0.26 TPSA 106.4 | ✓ Ro5 | ✓ Clean |
NC(=O)c1ccc(C[C@H](N)C(=O)O)cc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.