KpATCC43816 Protein target profile
3-octaprenyl-4-hydroxybenzoate carboxy-lyase family protein
Accession: VK055_1301
Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 8.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 28.188 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 94.91 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTAPIQDLRDAIALLQQHDNQYLETDHPVDPNAELAGVYRHIGAGGTVKRPTRIGPAMMFNNIKGYPHSRILVGMHASRQRAALLLGCEASQLALEVGKAVKKPVAPVVVPASSAPCQEQIFLADDPDFDLRTLLPAPTNTPIDAGPFFCLGLALASDPDDASLTDVTIHRLCVQGRDELSMFLAAGRHIEVFRQKAEAAGKPLPITINMGLDPAIYIGACFEAPTTPFGYNELGVAGALRQRPVELVQGVSVPEKAIARAEIVIEGELLPGVRVREDQHTNSGHAMPEFPGYCGGANPSLPVIKVKAVTMRNNAILQTLVGPGEEHTTLAGLPTEASIWNAVEAAIPGFLQNVYAHTAGGGKFLGILQVKKRQPADEGRQGQAALLALATYSELKNIILVDEDVDIFDSDDILWAMTTRMQGDVSITTIPGIRGHQLDPSQTPEYSPSIRGNGISCKTIFDCTVPWALKSHFERAPFADVDPRPFAPEYFARLEKNQGSAK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
1- GO:0016831 Catalysis of the nonhydrolytic addition or removal of a carboxyl group to or from a compound.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 342 | 465 | Gene3D | G3DSA:3.40.1670.10 | - |
| 4 | 478 | PANTHER | PTHR30108 | 3-OCTAPRENYL-4-HYDROXYBENZOATE CARBOXY-LYASE-RELATED |
| 4 | 478 | InterPro | IPR002830 | UbiD decarboxylyase family |
| 18 | 433 | Pfam | PF01977 | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase |
| 18 | 433 | InterPro | IPR002830 | UbiD decarboxylyase family |
| 326 | 483 | SUPERFAMILY | SSF143968 | UbiD C-terminal domain-like |
| 6 | 321 | SUPERFAMILY | SSF50475 | FMN-binding split barrel |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
1 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 4LU RCSB PDB | A2QHE5 | 525.5 Da LogP -0.09 TPSA 199.4 | 2 viol. | ✓ Clean |
Cc1cc2c3c(c1C)C(CC=[N+]3C4=C(N2C[C@@H]([C@@H]([…
|
|
| 4LV RCSB PDB | A2QHE5 | 162.2 Da LogP 2.17 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C/C(=C\c1ccccc1)/C(=O)O
|
|
| 4LW RCSB PDB | A2QHE5 | 166.2 Da LogP 2.08 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)/C=C(/C(=O)O)\F
|
|
| 4M4 RCSB PDB | A2QHE5 | 150.2 Da LogP 2.04 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
COc1cc(ccc1O)C=C
|
|
| 4MJ RCSB PDB | A2QHE5 | 644.6 Da LogP 1.32 TPSA 216.7 | 2 viol. | ✓ Clean |
Cc1cc2c3c(c1C)C(C[C@H](N3C4=C(N2C[C@@H]([C@@H](…
|
|
| 7D9 RCSB PDB | P0AAB5 | 606.5 Da LogP -0.64 TPSA 254.0 | 3 viol. | ✓ Clean |
Cc1cc2c3c(c1C)C(C[C@H](N3C4=C(N2C[C@@H]([C@@H](…
|
|
| BYN RCSB PDB | A2QHE5 | 542.5 Da LogP -0.13 TPSA 220.1 | 3 viol. | ✓ Clean |
Cc1cc2c3c(c1C)C(C[C@H](N3C4=C(N2C[C@@H]([C@@H](…
|
|
| CO2 RCSB PDB | A2QHE5 | 44.0 Da LogP -0.58 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C(=O)=O
|
|
| F5C RCSB PDB | A2QHE5 | 238.1 Da LogP 2.48 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C(=C/C(=O)O)\c1c(c(c(c(c1F)F)F)F)F
|
|
| FZZ RCSB PDB | A2QHE5 | 524.5 Da LogP 0.54 TPSA 209.0 | 2 viol. | ✓ Clean |
Cc1cc2c3c(c1C)C(CC3=NC4=C(N2C[C@@H]([C@@H]([C@@…
|
|
| JQ8 RCSB PDB | A2QHE5 | 146.1 Da LogP 1.12 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)C#CC(=O)O
|
|
| JQH RCSB PDB | A2QHE5 | 626.6 Da LogP 1.66 TPSA 192.5 | 2 viol. | ✓ Clean |
Cc1cc2c3c(c1C)C(C[C@@H]4[N@]3[C@]5(C(=C4)c6cccc…
|
|
| JQK RCSB PDB | A2QHE5 | 630.6 Da LogP 2.56 TPSA 199.9 | 2 viol. | ✓ Clean |
Cc1cc2c3c(c1C)C(C[C@H](N3C4=C(N2C[C@@H]([C@@H](…
|
|
| JQQ RCSB PDB | A2QHE5 | 648.6 Da LogP 2.50 TPSA 199.9 | 2 viol. | ✓ Clean |
Cc1cc2c3c(c1C)C(C[C@H](N3C4=C(N2C[C@@H]([C@@H](…
|
|
| JQZ RCSB PDB | A2QHE5 | — | — | — |
CC1=CC2=[N](C3=C4(C(=C([C@H]5[N]4=C2C(=C1C)C(C5…
|
|
| JRH RCSB PDB | A2QHE5 | 566.5 Da LogP 0.60 TPSA 192.5 | 2 viol. | ✓ Clean |
Cc1cc2c3c(c1C)C(C[C@@H]4[N@]3[C@]5([C@@H](C4)C)…
|
|
| JRK RCSB PDB | A2QHE5 | 608.5 Da LogP -0.03 TPSA 229.8 | 2 viol. | ✓ Clean |
Cc1cc2c3c(c1C)C(C[C@@H]4[N@]3[C@]5(C(=C4C(=O)O)…
|
|
| JRN RCSB PDB | A2QHE5 | 720.6 Da LogP 1.30 TPSA 200.9 | 2 viol. | ✓ Clean |
Cc1cc2c3c(c1C)C(C[C@H]([n+]3c4c([n+]2C[C@@H]([C…
|
|
| JSH RCSB PDB | A2QHE5 | 628.6 Da LogP 1.75 TPSA 192.5 | 2 viol. | ✓ Clean |
Cc1cc2c3c(c1C)C(C[C@@H]4[N@]3[C@]5([C@@H](C4)c6…
|
|
| SYN RCSB PDB | A2QHE5 | 104.2 Da LogP 2.33 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
C=Cc1ccccc1
|
|
| TCA RCSB PDB | A2QHE5 | 148.2 Da LogP 1.78 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)\C=C\C(=O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC12342729 ZINC | 1.000 | 238.1 Da LogP 2.48 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C/c1c(F)c(F)c(F)c(F)c1F
|
| ZINC14771652 ZINC | 1.000 | 216.4 Da LogP 3.26 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OCCCCCCCCCCCCCO
|
| ZINC15269439 ZINC | 1.000 | 272.5 Da LogP 4.82 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OCCCCCCCCCCCCCCCCCO
|
| ZINC1574339 ZINC | 1.000 | 202.3 Da LogP 2.87 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OCCCCCCCCCCCCO
|
| ZINC4202510 ZINC | 1.000 | 230.4 Da LogP 3.65 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OCCCCCCCCCCCCCCO
|
| ZINC4481119 ZINC | 1.000 | 238.1 Da LogP 2.48 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C\c1c(F)c(F)c(F)c(F)c1F
|
| ZINC4521552 ZINC | 1.000 | 258.4 Da LogP 4.43 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OCCCCCCCCCCCCCCCCO
|
| ZINC4600152 ZINC | 1.000 | 244.4 Da LogP 4.04 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OCCCCCCCCCCCCCCCO
|
| ZINC16951469 ZINC | 0.800 | 218.2 Da LogP 1.88 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C\c1ccc(/C=C\C(=O)O)cc1
|
| ZINC1857742971 ZINC | 0.800 | 218.2 Da LogP 1.88 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)C=Cc1ccc(C=CC(=O)O)cc1
|
| ZINC225518 ZINC | 0.800 | 218.2 Da LogP 1.88 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C/c1ccc(/C=C/C(=O)O)cc1
|
| ZINC4972290 ZINC | 0.800 | 218.2 Da LogP 1.88 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C\c1ccc(/C=C/C(=O)O)cc1
|
| ZINC153711 ZINC | 0.750 | 224.3 Da LogP 3.45 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C/c1ccc(-c2ccccc2)cc1
|
| ZINC20232541 ZINC | 0.750 | 224.3 Da LogP 3.45 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C\c1ccc(-c2ccccc2)cc1
|
| ZINC2053466799 ZINC | 0.750 | 224.3 Da LogP 3.45 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)C=Cc1ccc(-c2ccccc2)cc1
|
| ZINC5282356 ZINC | 0.750 | 262.4 Da LogP 4.76 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
C/C(=C\c1ccccc1)C(=O)/C(C)=C/c1ccccc1
|
| ZINC2053483728 ZINC | 0.739 | 218.2 Da LogP 1.88 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)C=Cc1cccc(C=CC(=O)O)c1
|
| ZINC242770 ZINC | 0.739 | 218.2 Da LogP 1.88 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C/c1cccc(/C=C/C(=O)O)c1
|
| ZINC6191548 ZINC | 0.739 | 218.2 Da LogP 1.88 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C\c1cccc(/C=C/C(=O)O)c1
|
| ZINC6191549 ZINC | 0.739 | 218.2 Da LogP 1.88 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C\c1cccc(/C=C\C(=O)O)c1
|
| ZINC84496209 ZINC | 0.739 | 222.2 Da LogP 2.79 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)C#Cc1ccc(-c2ccccc2)cc1
|
| ZINC12358705 ZINC | 0.727 | 234.3 Da LogP 3.98 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=C(C=Cc1ccccc1)C=Cc1ccccc1
|
| ZINC1504183 ZINC | 0.727 | 234.3 Da LogP 3.98 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=C(/C=C/c1ccccc1)/C=C/c1ccccc1
|
| ZINC16991034 ZINC | 0.727 | 262.3 Da LogP 3.55 TPSA 34.1 | ✓ Ro5 | Alert |
O=C(/C=C/c1ccccc1)C(=O)/C=C/c1ccccc1
|
| ZINC1857524274 ZINC | 0.727 | 234.3 Da LogP 3.98 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=C(C=Cc1ccccc1)/C=C\c1ccccc1
|
| ZINC29786395 ZINC | 0.727 | 234.3 Da LogP 3.98 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=C(/C=C\c1ccccc1)/C=C\c1ccccc1
|
| ZINC31636707 ZINC | 0.727 | 262.3 Da LogP 3.55 TPSA 34.1 | ✓ Ro5 | Alert |
O=C(/C=C\c1ccccc1)C(=O)/C=C\c1ccccc1
|
| ZINC3844946 ZINC | 0.727 | 214.2 Da LogP 0.56 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)C#Cc1cccc(C#CC(=O)O)c1
|
| ZINC4721555 ZINC | 0.727 | 262.3 Da LogP 3.55 TPSA 34.1 | ✓ Ro5 | Alert |
O=C(/C=C\c1ccccc1)C(=O)/C=C/c1ccccc1
|
| ZINC5014573 ZINC | 0.727 | 234.3 Da LogP 3.98 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=C(/C=C\c1ccccc1)/C=C/c1ccccc1
|
| ZINC185070 ZINC | 0.714 | 272.3 Da LogP 3.29 TPSA 58.9 | ✓ Ro5 | ✓ Clean |
COc1cc(/C=C/c2ccc(O)c(OC)c2)ccc1O
|
| ZINC3184478 ZINC | 0.714 | 230.3 Da LogP 2.66 TPSA 17.1 | ✓ Ro5 | Alert |
O=C(C#Cc1ccccc1)C#Cc1ccccc1
|
| ZINC34530182 ZINC | 0.696 | 294.3 Da LogP 3.55 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C/c1ccc(-c2ccc(/C=C/C(=O)O)cc2)cc1
|
| ZINC44201139 ZINC | 0.680 | 220.1 Da LogP 2.34 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C/c1c(F)c(F)cc(F)c1F
|
| ZINC1651125 ZINC | 0.667 | 276.3 Da LogP 3.94 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
O=C(/C=C/c1ccccc1)CC(=O)/C=C/c1ccccc1
|
| ZINC1857776708 ZINC | 0.667 | 224.3 Da LogP 3.45 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)C=Cc1cccc(-c2ccccc2)c1
|
| ZINC1927726910 ZINC | 0.667 | 288.1 Da LogP 2.78 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CC(=Cc1ccc(I)cc1)C(=O)O
|
| ZINC196664 ZINC | 0.667 | 250.1 Da LogP 2.35 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
COc1c(F)c(F)c(/C=C/C(=O)O)c(F)c1F
|
| ZINC21950987 ZINC | 0.667 | 224.3 Da LogP 3.45 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C/c1cccc(-c2ccccc2)c1
|
| ZINC2577965 ZINC | 0.667 | 240.3 Da LogP 3.58 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C/c1ccc(Oc2ccccc2)cc1
|
| ZINC31872164 ZINC | 0.667 | 276.3 Da LogP 3.94 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
O=C(/C=C\c1ccccc1)CC(=O)/C=C\c1ccccc1
|
| ZINC31872166 ZINC | 0.667 | 276.3 Da LogP 3.94 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
O=C(/C=C\c1ccccc1)CC(=O)/C=C/c1ccccc1
|
| ZINC3848644 ZINC | 0.667 | 288.1 Da LogP 2.78 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C/C(=C/c1ccc(I)cc1)C(=O)O
|
| ZINC5045937 ZINC | 0.667 | 222.3 Da LogP 3.97 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
C/C(=C/c1ccccc1)C(=O)c1ccccc1
|
| ZINC5203159 ZINC | 0.667 | 222.3 Da LogP 3.97 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
C/C(=C\c1ccccc1)C(=O)c1ccccc1
|
| ZINC5479866 ZINC | 0.667 | 288.1 Da LogP 2.78 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C/C(=C\c1ccc(I)cc1)C(=O)O
|
| ZINC86722755 ZINC | 0.667 | 245.0 Da LogP 2.84 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)/C(F)=C/c1ccc(Br)cc1
|
| ZINC4529040 ZINC | 0.655 | 241.1 Da LogP 2.94 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C/C(=C\c1cccc(Br)c1)C(=O)O
|
| ZINC16997495 ZINC | 0.645 | 300.3 Da LogP 2.57 TPSA 83.6 | ✓ Ro5 | Alert |
COc1cc(/C=N\N=C/c2ccc(O)c(OC)c2)ccc1O
|
| ZINC5022931 ZINC | 0.645 | 300.3 Da LogP 2.57 TPSA 83.6 | ✓ Ro5 | Alert |
COc1cc(/C=N\N=C\c2ccc(O)c(OC)c2)ccc1O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.