Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 45.161 Lower values reduce human off-target concern.
- Human E-value
- 1.36e-19
- Gut microbiome similarity
- 2.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 40.58 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 93.36 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MVTLSRLFIHPVKSMRGMGLTHAFADISGLAFDRLFMVTETDGTFITARQFPQMVKFIPAPLHDGLHLTAPDGSSAVVRFSDFATQAEPTEVWGNHFTALIAPAAVNQWLSGFFKRDVQLRWLGPQLTRRVKRHDAVPLSFADGYPYLLANEASLRDLQQRCPASVSIEQFRPNLVVTGAAAWDEDSWKVIRIGEVVFDVAKPCSRCIFTTVSPERGQKHPAGEPLETLKRFRTALDNGDVDFGQNLIARNSGVIRVGDEVEILTRGPAKAYGAGESDDTPAPEAQQQATVAIEWQGQQFTGNNQQVLLEQLEQQGIRVPYSCRAGICGSCRIRLEEGEVSPLKKNAVAGDGTILACSCVPKTALRLAP
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Gene Ontology (GO)
5- GO:0051537 Binding to a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
- GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
- GO:0030151 Binding to a molybdenum ion (Mo).
- GO:0051536 Binding to an iron-sulfur cluster, a combination of iron and sulfur atoms.
- GO:0030170 Binding to pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 4 | 132 | SUPERFAMILY | SSF141673 | MOSC N-terminal domain-like |
| 139 | 262 | Pfam | PF03473 | MOSC domain |
| 139 | 262 | InterPro | IPR005302 | Molybdenum cofactor sulfurase, C-terminal |
| 296 | 362 | Pfam | PF00111 | 2Fe-2S iron-sulfur cluster binding domain |
| 296 | 362 | InterPro | IPR001041 | 2Fe-2S ferredoxin-type iron-sulfur binding domain |
| 290 | 367 | CDD | cd00207 | fer2 |
| 290 | 367 | InterPro | IPR001041 | 2Fe-2S ferredoxin-type iron-sulfur binding domain |
| 1 | 116 | Pfam | PF03476 | MOSC N-terminal beta barrel domain |
| 1 | 116 | InterPro | IPR005303 | Molybdenum cofactor sulfurase, middle domain |
| 280 | 367 | SUPERFAMILY | SSF54292 | 2Fe-2S ferredoxin-like |
| 280 | 367 | InterPro | IPR036010 | 2Fe-2S ferredoxin-like superfamily |
| 115 | 264 | ProSiteProfiles | PS51340 | MOSC domain profile. |
| 115 | 264 | InterPro | IPR005302 | Molybdenum cofactor sulfurase, C-terminal |
| 287 | 369 | ProSiteProfiles | PS51085 | 2Fe-2S ferredoxin-type iron-sulfur binding domain profile. |
| 287 | 369 | InterPro | IPR001041 | 2Fe-2S ferredoxin-type iron-sulfur binding domain |
| 323 | 331 | ProSitePatterns | PS00197 | 2Fe-2S ferredoxin-type iron-sulfur binding region signature. |
| 323 | 331 | InterPro | IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site |
| 3 | 264 | SUPERFAMILY | SSF50800 | PK beta-barrel domain-like |
| 3 | 264 | InterPro | IPR011037 | Pyruvate kinase-like, insert domain superfamily |
| 272 | 368 | Gene3D | G3DSA:3.10.20.30 | - |
| 272 | 368 | InterPro | IPR012675 | Beta-grasp domain superfamily |
| 4 | 263 | PANTHER | PTHR14237 | MOLYBDOPTERIN COFACTOR SULFURASE MOSC |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GV44
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_1512
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| B3P RCSB PDB | Q5VT66 | 282.3 Da LogP -4.01 TPSA 145.4 | 1 viol. | ✓ Clean |
C(CNC(CO)(CO)CO)CNC(CO)(CO)CO
|
|
| BCR RCSB PDB | P0A3C9 | 536.9 Da LogP 12.61 TPSA 0.0 | 2 viol. | ✓ Clean |
CC1=C(C(CCC1)(C)C)\C=C\C(=C\C=C\C(=C\C=C\C=C(/C…
|
|
| DGD RCSB PDB | P0A3C9 | 949.3 Da LogP 7.61 TPSA 231.1 | 4 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](CO[C@H]1[C@@H]([C…
|
|
| EFK RCSB PDB | Q5VT66 | 128.9 Da LogP -0.68 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O[Mo]=O
|
|
| FES RCSB PDB | A0A067XG75 | 175.8 Da LogP 1.29 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
S1[Fe]S[Fe]1
|
|
| LHG RCSB PDB | P0A3C9 | 723.0 Da LogP 9.89 TPSA 148.8 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@…
|
|
| LMG RCSB PDB | P0A3C9 | 787.2 Da LogP 9.78 TPSA 152.0 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](CO[C@H]1[C@@H]([C…
|
|
| MOO RCSB PDB | Q5VT66 | 159.9 Da LogP -2.62 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
[O-][Mo](=O)(=O)[O-]
|
|
| MTE RCSB PDB | Q5VT66 | 395.4 Da LogP -0.54 TPSA 171.8 | 1 viol. | ✓ Clean |
C([C@@H]1C(=C([C@H]2[C@@H](O1)NC3=C(N2)C(=O)NC(…
|
|
| PQN RCSB PDB | P0A3C9 | 450.7 Da LogP 9.16 TPSA 34.1 | 1 viol. | Alert |
CC1=C(C(=O)c2ccccc2C1=O)C\C=C(/C)\CCC[C@H](C)CC…
|
|
| SQD RCSB PDB | P0A3C9 | 795.1 Da LogP 8.12 TPSA 186.1 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](COC1[C@@H]([C@H]([C…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC102191119 ZINC | 1.000 | 498.6 Da LogP 3.65 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@@H](O)CO…
|
| ZINC4521259 ZINC | 1.000 | 282.3 Da LogP -4.01 TPSA 145.4 | 1 viol. | ✓ Clean |
OCC(CO)(CO)NCCCNC(CO)(CO)CO
|
| ZINC58649551 ZINC | 1.000 | 498.6 Da LogP 3.65 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@H](O)CO)…
|
| ZINC102191158 ZINC | 0.795 | 456.5 Da LogP 3.08 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@@](=O)(O)OC[C@…
|
| ZINC14880758 ZINC | 0.795 | 484.6 Da LogP 3.86 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@](=O)(O)OC[…
|
| ZINC14880760 ZINC | 0.795 | 484.6 Da LogP 3.86 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@](=O)(O)OC[C…
|
| ZINC53683910 ZINC | 0.795 | 484.6 Da LogP 3.86 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@@](=O)(O)OC[…
|
| ZINC62592202 ZINC | 0.795 | 456.5 Da LogP 3.08 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@@](=O)(O)OC[C@…
|
| ZINC62592203 ZINC | 0.795 | 456.5 Da LogP 3.08 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OC[C…
|
| ZINC62592204 ZINC | 0.795 | 484.6 Da LogP 3.86 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OC…
|
| ZINC96094841 ZINC | 0.795 | 456.5 Da LogP 3.08 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OC[C…
|
| ZINC102190506 ZINC | 0.729 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OCCN)OC(=O)CC…
|
| ZINC102190512 ZINC | 0.729 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCCN)OC(=O)C…
|
| ZINC36178999 ZINC | 0.711 | 424.5 Da LogP 4.27 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](COP(=O)(O)O)OC(=O)CCCCCCC
|
| ZINC36179002 ZINC | 0.711 | 424.5 Da LogP 4.27 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O)CCCCCCC
|
| ZINC44830468 ZINC | 0.711 | 346.5 Da LogP 4.93 TPSA 60.7 | ✓ Ro5 | ✓ Clean |
CC1=C(/C=C\C(C)=C/C=C/C(C)=C\CCC(O)(O)O)C(C)(C)…
|
| ZINC95908757 ZINC | 0.711 | 346.5 Da LogP 4.93 TPSA 60.7 | ✓ Ro5 | ✓ Clean |
CC1=C(/C=C\C(C)=C/C=C\C(C)=C/CCC(O)(O)O)C(C)(C)…
|
| ZINC27416437 ZINC | 0.708 | 411.4 Da LogP 2.69 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCCN)OC(=O)CCCCC
|
| ZINC33902364 ZINC | 0.708 | 411.4 Da LogP 2.69 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCCN)OC(=O)CCC…
|
| ZINC13543394 ZINC | 0.694 | 455.4 Da LogP 2.15 TPSA 171.7 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@H](N)C(=O)…
|
| ZINC5820131 ZINC | 0.689 | 368.4 Da LogP 2.71 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](COP(=O)(O)O)OC(=O)CCCCC
|
| ZINC5820134 ZINC | 0.689 | 368.4 Da LogP 2.71 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O)CCCCC
|
| ZINC13544781 ZINC | 0.686 | 482.6 Da LogP 4.22 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)OC[C@@H](CO[P@](=O)(O)OCC[N+](C)(C)C…
|
| ZINC13544783 ZINC | 0.686 | 482.6 Da LogP 4.22 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCC[N+](C)(C)C)…
|
| ZINC13543439 ZINC | 0.667 | 454.5 Da LogP 3.44 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](CO[P@](=O)(O)OCC[N+](C)(C)C)…
|
| ZINC13543441 ZINC | 0.667 | 454.5 Da LogP 3.44 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCC[N+](C)(C)C)O…
|
| ZINC17284934 ZINC | 0.650 | 234.3 Da LogP 4.10 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CC1=C(/C=C\C(C)=C/C(=O)O)C(C)(C)CCC1
|
| ZINC17284937 ZINC | 0.650 | 234.3 Da LogP 4.10 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CC1=C(/C=C/C(C)=C\C(=O)O)C(C)(C)CCC1
|
| ZINC22061499 ZINC | 0.650 | 220.4 Da LogP 4.01 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CC1=C(/C=C/C(C)=C/CO)C(C)(C)CCC1
|
| ZINC4430042 ZINC | 0.650 | 234.3 Da LogP 4.10 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CC1=C(/C=C/C(C)=C/C(=O)O)C(C)(C)CCC1
|
| ZINC65748979 ZINC | 0.650 | 214.4 Da LogP 4.65 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
C#C/C=C(C)/C=C/C1=C(C)CCCC1(C)C
|
| ZINC8613746 ZINC | 0.650 | 234.3 Da LogP 4.10 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CC1=C(/C=C\C(C)=C\C(=O)O)C(C)(C)CCC1
|
| ZINC257355159 ZINC | 0.648 | 496.6 Da LogP -1.71 TPSA 195.6 | 2 viol. | ✓ Clean |
CCCCCCCCCC(=O)OC[C@@H]1O[C@H](O[C@H]2O[C@H](CO)…
|
| ZINC257355160 ZINC | 0.648 | 496.6 Da LogP -1.71 TPSA 195.6 | 2 viol. | ✓ Clean |
CCCCCCCCCC(=O)OC[C@@H]1O[C@H](O[C@H]2O[C@H](CO)…
|
| ZINC257355161 ZINC | 0.648 | 496.6 Da LogP -1.71 TPSA 195.6 | 2 viol. | ✓ Clean |
CCCCCCCCCC(=O)OC[C@@H]1O[C@H](O[C@H]2O[C@H](CO)…
|
| ZINC257355162 ZINC | 0.648 | 496.6 Da LogP -1.71 TPSA 195.6 | 2 viol. | ✓ Clean |
CCCCCCCCCC(=O)OC[C@@H]1O[C@H](O[C@H]2O[C@H](CO)…
|
| ZINC257373326 ZINC | 0.648 | 468.5 Da LogP -2.49 TPSA 195.6 | 2 viol. | ✓ Clean |
CCCCCCCC(=O)OC[C@@H]1O[C@H](O[C@H]2O[C@H](CO)[C…
|
| ZINC257373327 ZINC | 0.648 | 468.5 Da LogP -2.49 TPSA 195.6 | 2 viol. | ✓ Clean |
CCCCCCCC(=O)OC[C@@H]1O[C@H](O[C@H]2O[C@H](CO)[C…
|
| ZINC257373328 ZINC | 0.648 | 468.5 Da LogP -2.49 TPSA 195.6 | 2 viol. | ✓ Clean |
CCCCCCCC(=O)OC[C@@H]1O[C@H](O[C@H]2O[C@H](CO)[C…
|
| ZINC257373329 ZINC | 0.648 | 468.5 Da LogP -2.49 TPSA 195.6 | 2 viol. | ✓ Clean |
CCCCCCCC(=O)OC[C@@H]1O[C@H](O[C@H]2O[C@H](CO)[C…
|
| ZINC115591405 ZINC | 0.636 | 373.6 Da LogP 4.55 TPSA 72.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCCCCNC(CO)(CO)CO
|
| ZINC115591837 ZINC | 0.636 | 317.5 Da LogP 2.99 TPSA 72.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCNC(CO)(CO)CO
|
| ZINC143575268 ZINC | 0.636 | 289.5 Da LogP 2.21 TPSA 72.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCNC(CO)(CO)CO
|
| ZINC2322313 ZINC | 0.636 | 233.4 Da LogP 0.65 TPSA 72.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCCNC(CO)(CO)CO
|
| ZINC36079847 ZINC | 0.636 | 344.5 Da LogP 4.15 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](CO)OC(=O)CCCCCCC
|
| ZINC8214428 ZINC | 0.636 | 344.5 Da LogP 4.15 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO)OC(=O)CCCCCCC
|
| ZINC97996983 ZINC | 0.636 | 345.6 Da LogP 3.77 TPSA 72.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCCNC(CO)(CO)CO
|
| ZINC100503478 ZINC | 0.628 | 260.4 Da LogP 2.41 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840884 ZINC | 0.628 | 302.5 Da LogP 3.58 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC38153421 ZINC | 0.628 | 246.3 Da LogP 2.02 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)OC[C@@H](O)CO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.