KpATCC43816 Protein target profile

ca2+-binding protein involved in chromosome partitioning

Accession: VK055_1535

Gene: mukF AIK80155.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A6T714
Length 440
Pocket druggability (P2Rank · AlphaFold DB model) 0.025
Functional annotation 0 EC 3 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
93.182 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
90.15 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.025
Structure A6T714
Pocket Pocket 1
Druggability (FPocket) 0.889
Structure A6T714
Pocket Pocket 1
ColabFold model
P2Rank 0.041 · Pocket 1
FPocket 0.645 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 142 / 4744 genomes with a hit
Prevalence 3.0%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSEFSQTVPELVAWARKNDFSISLPVDRLSFLLAIATLNGERLEGEMSEGELVDAFRHVSDAFEQTSETISQRANNAINDLVRQRLLNRFTSEITEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVFAPLKYSVAEIFDSIDLTQRIMDEQQQLVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLDAAGDKLQANLLRIQDSTMARDDLHFVDRLVFDLQSKLDRIVSWGQQAIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMRDEEMALRDEEVTGELPADLEFEEFNEIREQLAALIEAQLAVYKEKGIPLDLGLVAREFLAQYPRGRHFDVARIVVDQAVQLGVAQADFTGLPAKWQPINDYGAKVQAHVIDKY

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

3
  • GO:0005509 Binding to a calcium ion (Ca2+).
  • GO:0007059 The process in which genetic material, in the form of chromosomes, is organized into specific structures and then physically separated and apportioned to two or more sets. In eukaryotes, chromosome segregation begins with the condensation of chromosomes, includes chromosome separation, and ends when chromosomes have completed movement to the spindle poles.
  • GO:0006260 The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by the origin recognition complex, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

22 records
Show feature table
Start End DB Term Name
1 440 Hamap MF_01803 Chromosome partition protein MukF [mukF].
1 440 InterPro IPR005582 Chromosome partition protein MukF
24 118 Gene3D G3DSA:1.10.10.10 -
24 118 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
3 117 Pfam PF03882 MukF winged-helix domain
3 117 InterPro IPR033439 Chromosome partition protein MukF, winged-helix domain
342 438 CDD cd16337 MukF_C
342 438 InterPro IPR033441 Chromosome partition protein MukF, C-terminal domain
353 440 Gene3D G3DSA:1.10.225.40 -
353 440 InterPro IPR038198 MukF, C-terminal domain superfamily
13 328 CDD cd16335 MukF_N
8 118 SUPERFAMILY SSF46785 Winged helix DNA-binding domain
8 118 InterPro IPR036390 Winged helix DNA-binding domain superfamily
119 311 Gene3D G3DSA:1.20.58.590 Chromosome partition protein MukF, middle domain
119 311 InterPro IPR036141 MukF, middle domain superfamily
119 281 SUPERFAMILY SSF140570 MukF C-terminal domain-like
119 281 InterPro IPR036141 MukF, middle domain superfamily
121 281 Pfam PF17192 MukF middle domain
121 281 InterPro IPR033440 Chromosome partition protein MukF, middle domain
1 440 PIRSF PIRSF018282 MukF
283 440 Pfam PF17193 MukF C-terminal domain
283 440 InterPro IPR033441 Chromosome partition protein MukF, C-terminal domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.025
Likely same site as FPocket 1 3.0 Å 7 shared residues 88% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.889
Likely same site as P2Rank 1 3.0 Å 7 shared residues 88% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #3
0.376
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A6T714
AlphaFold DB full sequence Viewing
ColabFold VK055_1535
ColabFold full sequence Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.