KpATCC43816 Protein target profile

formate transporter FocA

Accession: VK055_1552

Gene: focA AIK80172.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GL09
Length 285
Pocket druggability (P2Rank · AlphaFold DB model) 0.742
Direct ligand evidence 0 52 total records
Functional annotation 0 EC 7 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
53.232 Higher values support similarity to known essential genes.
DEG E-value
3.76e-104 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
94.77 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.742
Structure A0A0H3GL09
Pocket Pocket 1
Druggability (FPocket) 0.876
Structure A0A0H3GL09
Pocket Pocket 7
ColabFold model
P2Rank 0.673 · Pocket 1
FPocket 0.686 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 144 / 4744 genomes with a hit
Prevalence 3.0%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MKADNPFDLLLPAAMAKVAEEAGVYKATKHPMKTFYLAITAGVFISIAFVFYITATTGTAAMPYGIAKLIGGICFSLGLILCVICGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFGNLVGALLFVLLMWLSGEYMTANGGWGLNVLQTADHKMHHTFVEAVSLGILANLMVCLAVWMSYSGRSLMDKAMIMVLPVAMFVASGFEHSIANMFMIPMGIVIRNFASPEFWTAIGSTPESFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRGNDHH

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

7 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

7
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0015724 The directed movement of formate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0015499 Enables the transfer of formate from one side of a membrane to the other. Formate is also known as methanoate, the anion HCOO- derived from methanoic (formic) acid.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0042802 Binding to an identical protein or proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

34 records
Show feature table
Start End DB Term Name
135 163 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
14 279 NCBIfam TIGR04060 formate transporter FocA
14 279 InterPro IPR023999 Formate transporter FocA
83 92 ProSitePatterns PS01005 Formate and nitrite transporters signature 1.
83 92 InterPro IPR024002 Formate/nitrite transporter, conserved site
35 55 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
195 223 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
77 99 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
256 278 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
113 134 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 268 Gene3D G3DSA:1.20.1080.10 Glycerol uptake facilitator protein.
1 268 InterPro IPR023271 Aquaporin-like
119 141 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
26 280 NCBIfam TIGR00790 formate/nitrite family transporter
26 280 InterPro IPR000292 Formate/nitrite transporter
184 194 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
168 178 ProSitePatterns PS01006 Formate and nitrite transporters signature 2.
168 178 InterPro IPR024002 Formate/nitrite transporter, conserved site
56 74 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
16 276 Pfam PF01226 Formate/nitrite transporter
16 276 InterPro IPR000292 Formate/nitrite transporter
1 34 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
164 183 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
75 101 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
161 183 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 282 PANTHER PTHR30520 FORMATE TRANSPORTER-RELATED
1 282 InterPro IPR000292 Formate/nitrite transporter
224 254 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
102 112 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
195 217 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
278 285 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
255 277 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 268 FunFam G3DSA:1.20.1080.10:FF:000006 Formate transporter FocA
35 57 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.742
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.394
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.014
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.009
Likely same site as FPocket 7 3.6 Å 6 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.003
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #7
0.876
Likely same site as P2Rank 4 3.6 Å 6 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #17
0.252
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GL09
AlphaFold DB full sequence Viewing
ColabFold VK055_1552
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
HV6 PDB via homolog 312.2 Da · LogP 3.22 · TPSA 66.8 Open detail RCSB PDB
R7M PDB via homolog Detail RCSB PDB
ZINC305070 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC305075 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC2269662 ZINC proposed compound · Tanimoto 0.844 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
HV6 RCSB PDB O77389 312.2 Da LogP 3.22 TPSA 66.8 ✓ Ro5 ✓ Clean COc1ccc(c(c1)O)C(=O)/C=C(/C(C(F)(F)F)(F)F)\O
R7M RCSB PDB O77389 312.2 Da LogP 2.55 TPSA 55.8 ✓ Ro5 ✓ Clean COc1ccc2c(c1)O[C@](CC2=O)(C(C(F)(F)F)(F)F)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.