Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 4.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 88.78 Higher values support similarity to known essential genes.
- DEG E-value
- 1.23e-141 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 97.01 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTTQYGFFIDSARCTGCKTCELACKDYKNLTPEVSFRRIYEYAGGDWQEDNGVWQQNVFAYYLSIACNHCEDPACTKVCPSGAMHKREDGFVVVNEEVCIGCRYCHMACPYGAPQYNADKGHMTKCDGCHERVAEGKKPICVESCPLRALDFGPIAELRAKHGQLAAVAPLPSAHFTRPSIVIKPNANARPCGDTTGYLANPKEV
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Gene Ontology (GO)
4- GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
- GO:0046872 Binding to a metal ion.
- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
- GO:0045333 The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which either requires oxygen (aerobic respiration) or does not (anaerobic respiration).
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 4 | 163 | NCBIfam | TIGR02951 | dimethylsulfoxide reductase subunit B |
| 4 | 163 | InterPro | IPR014297 | Dimethylsulphoxide reductase, chain B |
| 5 | 181 | Gene3D | G3DSA:3.30.70.20 | - |
| 3 | 195 | SUPERFAMILY | SSF54862 | 4Fe-4S ferredoxins |
| 6 | 153 | CDD | cd16371 | DMSOR_beta_like |
| 99 | 110 | ProSitePatterns | PS00198 | 4Fe-4S ferredoxin-type iron-sulfur binding region signature. |
| 99 | 110 | InterPro | IPR017900 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site |
| 73 | 125 | FunFam | G3DSA:3.30.70.20:FF:000003 | Dimethyl sulfoxide reductase subunit B |
| 73 | 125 | Gene3D | G3DSA:3.30.70.20 | - |
| 57 | 89 | ProSiteProfiles | PS51379 | 4Fe-4S ferredoxin-type iron-sulfur binding domain profile. |
| 57 | 89 | InterPro | IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
| 12 | 26 | Pfam | PF12800 | 4Fe-4S binding domain |
| 12 | 26 | InterPro | IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
| 3 | 190 | PANTHER | PTHR43177 | PROTEIN NRFC |
| 5 | 35 | ProSiteProfiles | PS51379 | 4Fe-4S ferredoxin-type iron-sulfur binding domain profile. |
| 5 | 35 | InterPro | IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
| 90 | 119 | ProSiteProfiles | PS51379 | 4Fe-4S ferredoxin-type iron-sulfur binding domain profile. |
| 90 | 119 | InterPro | IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
| 59 | 153 | Pfam | PF13247 | 4Fe-4S dicluster domain |
| 59 | 153 | InterPro | IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GUZ3
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_1558
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 2MD RCSB PDB | Q8GC87 | 742.6 Da LogP -2.53 TPSA 346.6 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@@](=…
|
|
| 3PH RCSB PDB | P11349 | 705.0 Da LogP 12.07 TPSA 119.4 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O…
|
|
| 6MO RCSB PDB | P11349 | 95.9 Da LogP -0.00 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
[Mo+6]
|
|
| AGA RCSB PDB | P11349 | 455.5 Da LogP 1.85 TPSA 151.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)O[C@H](COC(=O)CCCC)COP(=O)([O-])OC[…
|
|
| BSY RCSB PDB | G8QM54 | 128.0 Da LogP -2.25 TPSA 60.4 | ✓ Ro5 | ✓ Clean |
O[Se](=O)[O-]
|
|
| CDL RCSB PDB | P0AAJ3 | 1464.1 Da LogP 23.31 TPSA 242.6 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)([O-])OCC(…
|
|
| F3S RCSB PDB | P11349 | 295.8 Da LogP 2.59 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
S1[Fe]2S[Fe]3[S]2[Fe]1S3
|
|
| HQO RCSB PDB | P0AAJ3 | 259.3 Da LogP 3.69 TPSA 47.2 | ✓ Ro5 | Alert |
CCCCCCCc1cc(c2ccccc2[n+]1[O-])O
|
|
| MD1 RCSB PDB | P11349 | 740.6 Da LogP -2.13 TPSA 358.0 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…
|
|
| MGD RCSB PDB | Q7WTT9 | 740.6 Da LogP -2.06 TPSA 346.6 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@@](=…
|
|
| MO RCSB PDB | Q7WTT9 | 95.9 Da LogP -0.00 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
[Mo]
|
|
| O RCSB PDB | Q7WTT9 | 18.0 Da LogP -0.82 TPSA 31.5 | ✓ Ro5 | ✓ Clean |
O
|
|
| PCI RCSB PDB | P11349 | 266.3 Da LogP 4.66 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
c1(c(c(c(c(c1Cl)Cl)Cl)Cl)Cl)O
|
|
| PG5 RCSB PDB | Q7WTT9 | 178.2 Da LogP 0.31 TPSA 36.9 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOC
|
|
| W RCSB PDB | Q8GC87 | 183.8 Da LogP -0.00 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
[W+6]
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1529471 ZINC | 1.000 | 266.3 Da LogP 4.66 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
Oc1c(Cl)c(Cl)c(Cl)c(Cl)c1Cl
|
| ZINC1529909 ZINC | 1.000 | 259.3 Da LogP 3.69 TPSA 47.2 | ✓ Ro5 | Alert |
CCCCCCCc1cc(O)c2ccccc2[n+]1[O-]
|
| ZINC1692489 ZINC | 1.000 | 222.3 Da LogP 0.33 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOC
|
| ZINC4530388 ZINC | 1.000 | 266.3 Da LogP 0.35 TPSA 55.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOC
|
| ZINC5701172 ZINC | 1.000 | 310.4 Da LogP 0.36 TPSA 64.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOC
|
| ZINC5997861 ZINC | 1.000 | 398.5 Da LogP 0.40 TPSA 83.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOC
|
| ZINC225408 ZINC | 0.900 | 247.9 Da LogP 3.71 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
Oc1c(Cl)c(Cl)c(O)c(Cl)c1Cl
|
| ZINC154748 ZINC | 0.818 | 247.9 Da LogP 3.71 TPSA 40.5 | ✓ Ro5 | Alert |
Oc1c(O)c(Cl)c(Cl)c(Cl)c1Cl
|
| ZINC34764844 ZINC | 0.733 | 206.3 Da LogP 1.09 TPSA 36.9 | ✓ Ro5 | ✓ Clean |
CCCOCCOCCOCCOC
|
| ZINC102191119 ZINC | 0.708 | 498.6 Da LogP 3.65 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@@H](O)CO…
|
| ZINC58649551 ZINC | 0.708 | 498.6 Da LogP 3.65 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@H](O)CO)…
|
| ZINC36178999 ZINC | 0.705 | 424.5 Da LogP 4.27 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](COP(=O)(O)O)OC(=O)CCCCCCC
|
| ZINC36179002 ZINC | 0.705 | 424.5 Da LogP 4.27 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O)CCCCCCC
|
| ZINC140264883 ZINC | 0.688 | 223.3 Da LogP -0.43 TPSA 72.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCON
|
| ZINC143705779 ZINC | 0.688 | 443.5 Da LogP -0.34 TPSA 118.3 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCON
|
| ZINC1580161 ZINC | 0.688 | 208.3 Da LogP -0.33 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCO
|
| ZINC16052118 ZINC | 0.688 | 340.4 Da LogP -0.28 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCO
|
| ZINC16052257 ZINC | 0.688 | 384.5 Da LogP -0.26 TPSA 94.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC33358855 ZINC | 0.688 | 207.3 Da LogP -0.36 TPSA 62.9 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCN
|
| ZINC34317654 ZINC | 0.688 | 472.6 Da LogP -0.23 TPSA 112.5 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC44076059 ZINC | 0.688 | 428.5 Da LogP -0.24 TPSA 103.3 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC44583772 ZINC | 0.688 | 356.5 Da LogP 0.66 TPSA 64.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCS
|
| ZINC5024003 ZINC | 0.688 | 251.3 Da LogP -0.34 TPSA 72.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCN
|
| ZINC5210101 ZINC | 0.688 | 252.3 Da LogP -0.31 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCO
|
| ZINC575432090 ZINC | 0.688 | 355.4 Da LogP -0.38 TPSA 99.9 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCON
|
| ZINC575432265 ZINC | 0.688 | 399.5 Da LogP -0.36 TPSA 109.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCON
|
| ZINC5997860 ZINC | 0.688 | 296.4 Da LogP -0.29 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCO
|
| ZINC71254558 ZINC | 0.688 | 444.6 Da LogP 0.70 TPSA 83.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCS
|
| ZINC71254563 ZINC | 0.688 | 488.6 Da LogP 0.71 TPSA 92.3 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCS
|
| ZINC80685077 ZINC | 0.688 | 427.5 Da LogP -0.28 TPSA 109.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCN
|
| ZINC83253927 ZINC | 0.688 | 400.5 Da LogP 0.68 TPSA 73.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCS
|
| ZINC83253930 ZINC | 0.688 | 224.3 Da LogP 0.61 TPSA 36.9 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCS
|
| ZINC83253936 ZINC | 0.688 | 383.5 Da LogP -0.29 TPSA 99.9 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCN
|
| ZINC90556279 ZINC | 0.688 | 295.4 Da LogP -0.33 TPSA 81.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCN
|
| ZINC90556280 ZINC | 0.688 | 339.4 Da LogP -0.31 TPSA 90.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCN
|
| ZINC90556286 ZINC | 0.688 | 312.4 Da LogP 0.65 TPSA 55.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCS
|
| ZINC90556287 ZINC | 0.688 | 268.4 Da LogP 0.63 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCS
|
| ZINC96503353 ZINC | 0.688 | 471.6 Da LogP -0.26 TPSA 118.3 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCN
|
| ZINC104869865 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(O…
|
| ZINC12504289 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC34541308 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC35000839 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC45284491 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC80639694 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC8215481 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC5820131 ZINC | 0.682 | 368.4 Da LogP 2.71 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](COP(=O)(O)O)OC(=O)CCCCC
|
| ZINC5820134 ZINC | 0.682 | 368.4 Da LogP 2.71 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O)CCCCC
|
| ZINC4521879 ZINC | 0.650 | 386.5 Da LogP 4.73 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OCC(COC(=O)CCCCC)OC(=O)CCCCC
|
| ZINC113456917 ZINC | 0.647 | 220.3 Da LogP 1.48 TPSA 36.9 | ✓ Ro5 | ✓ Clean |
CCCCOCCOCCOCCOC
|
| ZINC34303570 ZINC | 0.647 | 264.4 Da LogP 1.50 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
CCCCOCCOCCOCCOCCOC
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.