Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 36.533 Lower values reduce human off-target concern.
- Human E-value
- 7.61e-63
- Gut microbiome similarity
- 28.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 94.186 Higher values support similarity to known essential genes.
- DEG E-value
- 0.0 Smaller values mean stronger essential-gene similarity.
Localization
- Localization
- Cytoplasmic
Structure confidence
- ColabFold pLDDT
- 97.14 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MLDPNLLRTEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQAKARGEDIEPLRLEVNKLGEQLDAAKSELETLLAEIRDIALAIPNIPHDDVPVGRDENDNVEVSRWGTPRQFDFEVRDHVTLGEMHGGLDFAAAVKLTGSRFVVMKGQLARLHRALAQFMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTAEVPLTNLVRDEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRPEDSMAALEEMTGHAEKVLQLLGLPYRKVALCTGDMGFSACKTYDLEVWVPAQNTYREISSCSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVALMENYQQADGCIEIPEVLRPYMRGLEYIG
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
6- GO:0006434 The process of coupling serine to seryl-tRNA, catalyzed by seryl-tRNA synthetase. The seryl-tRNA synthetase is a class-II synthetase. The activated amino acid is transferred to the 3'-OH group of a serine-accetping tRNA.
- GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
- GO:0004812 Catalysis of the formation of aminoacyl-tRNA from ATP, amino acid, and tRNA with the release of diphosphate and AMP.
- GO:0000166 Binding to a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
- GO:0006418 The synthesis of aminoacyl tRNA by the formation of an ester bond between the 3'-hydroxyl group of the most 3' adenosine of the tRNA and the alpha carboxylic acid group of an amino acid, to be used in ribosome-mediated polypeptide synthesis.
- GO:0004828 Catalysis of the reaction: ATP + L-serine + tRNA(Ser) = AMP + diphosphate + L-seryl-tRNA(Ser). Also catalyzes the formation of L-seryl-tRNA(Sec) from tRNA(Sec), the special tRNA for selenocysteine.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 68 | 102 | Coils | Coil | Coil |
| 119 | 423 | CDD | cd00770 | SerRS_core |
| 119 | 423 | InterPro | IPR033729 | Serine-tRNA ligase catalytic core domain |
| 1 | 107 | Pfam | PF02403 | Seryl-tRNA synthetase N-terminal domain |
| 1 | 107 | InterPro | IPR015866 | Serine-tRNA synthetase, type1, N-terminal |
| 171 | 421 | ProSiteProfiles | PS50862 | Aminoacyl-transfer RNA synthetases class-II family profile. |
| 171 | 421 | InterPro | IPR006195 | Aminoacyl-tRNA synthetase, class II |
| 1 | 112 | SUPERFAMILY | SSF46589 | tRNA-binding arm |
| 1 | 112 | InterPro | IPR010978 | Class I and II aminoacyl-tRNA synthetase, tRNA-binding arm |
| 30 | 50 | Coils | Coil | Coil |
| 105 | 430 | FunFam | G3DSA:3.30.930.10:FF:000018 | Serine--tRNA ligase |
| 1 | 104 | FunFam | G3DSA:1.10.287.40:FF:000001 | Serine--tRNA ligase |
| 228 | 406 | Pfam | PF00587 | tRNA synthetase class II core domain (G, H, P, S and T) |
| 228 | 406 | InterPro | IPR002314 | Aminoacyl-tRNA synthetase, class II (G/ P/ S/T) |
| 116 | 424 | SUPERFAMILY | SSF55681 | Class II aaRS and biotin synthetases |
| 116 | 424 | InterPro | IPR045864 | Class II Aminoacyl-tRNA synthetase/Biotinyl protein ligase (BPL) and lipoyl protein ligase (LPL) |
| 282 | 295 | PRINTS | PR00981 | Seryl-tRNA synthetase signature |
| 282 | 295 | InterPro | IPR002317 | Serine-tRNA ligase, type1 |
| 322 | 335 | PRINTS | PR00981 | Seryl-tRNA synthetase signature |
| 322 | 335 | InterPro | IPR002317 | Serine-tRNA ligase, type1 |
| 270 | 282 | PRINTS | PR00981 | Seryl-tRNA synthetase signature |
| 270 | 282 | InterPro | IPR002317 | Serine-tRNA ligase, type1 |
| 339 | 355 | PRINTS | PR00981 | Seryl-tRNA synthetase signature |
| 339 | 355 | InterPro | IPR002317 | Serine-tRNA ligase, type1 |
| 357 | 373 | PRINTS | PR00981 | Seryl-tRNA synthetase signature |
| 357 | 373 | InterPro | IPR002317 | Serine-tRNA ligase, type1 |
| 1 | 429 | PANTHER | PTHR43697 | SERYL-TRNA SYNTHETASE |
| 1 | 104 | Gene3D | G3DSA:1.10.287.40 | - |
| 1 | 104 | InterPro | IPR042103 | Serine-tRNA synthetase, type1, N-terminal domain superfamily |
| 1 | 430 | PIRSF | PIRSF001529 | Ser-tRNA_ligase |
| 1 | 430 | InterPro | IPR002317 | Serine-tRNA ligase, type1 |
| 1 | 428 | Hamap | MF_00176 | Serine--tRNA ligase [serS]. |
| 1 | 428 | InterPro | IPR002317 | Serine-tRNA ligase, type1 |
| 1 | 423 | NCBIfam | TIGR00414 | serine--tRNA ligase |
| 1 | 423 | InterPro | IPR002317 | Serine-tRNA ligase, type1 |
| 105 | 430 | Gene3D | G3DSA:3.30.930.10 | Bira Bifunctional Protein; Domain 2 |
| 105 | 430 | InterPro | IPR045864 | Class II Aminoacyl-tRNA synthetase/Biotinyl protein ligase (BPL) and lipoyl protein ligase (LPL) |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
All structural evidence
Structural evidence
6 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
PDB
6H9X
|
X-ray | — | A | — | Loaded | |
|
PDB
6HHY
|
X-ray | — | A | — | Loaded | |
|
PDB
6HHZ
|
X-ray | — | A | — | Loaded | |
|
PDB
6HI0
|
X-ray | — | A | — | Loaded | |
|
PDB
6S30
|
X-ray | — | A | — | Loaded | |
|
PDB
7AP1
|
X-ray | — | A | — | Viewing | |
|
ColabFold
VK055_1560
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| FZK RCSB PDB | A6T6Z0 | 410.4 Da LogP -5.15 TPSA 223.3 | 2 viol. | ✓ Clean |
C1=CN(C(=O)NC1=O)[C@H]2[C@@H]([C@@H]([C@H](O2)C…
|
|
| FZQ RCSB PDB | A6T6Z0 | 409.4 Da LogP -4.86 TPSA 229.3 | 2 viol. | ✓ Clean |
C1=CN(C(=O)N=C1N)[C@H]2[C@@H]([C@@H]([C@H](O2)C…
|
|
| FZT RCSB PDB | A6T6Z0 | 424.4 Da LogP -5.14 TPSA 212.4 | 1 viol. | ✓ Clean |
CN1C(=O)C=CN(C1=O)[C@H]2[C@@H]([C@@H]([C@H](O2)…
|
|
| JPE RCSB PDB | P0A8L1 | 510.5 Da LogP -3.21 TPSA 250.9 | 3 viol. | ✓ Clean |
c1cc(cnc1)c2nc(c3c(n2)n(cn3)[C@H]4[C@@H]([C@@H]…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| SSA ChEMBL | P0A8L1 | 9.74 ~0.2 nM | 433.4 Da LogP -4.28 TPSA 238.0 | 2 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
| CHEMBL4467050 ChEMBL | P95689 | 6.42 ~380.2 nM | 559.3 Da LogP -3.67 TPSA 238.0 | 3 viol. | ✓ Clean |
Nc1nc(I)nc2c1ncn2[C@@H]1O[C@H](COS(=O)(=O)NC(=O…
|
| CHEMBL4529844 ChEMBL | P0A8L1 | 6.35 ~446.7 nM | 467.8 Da LogP -3.62 TPSA 238.0 | 2 viol. | ✓ Clean |
Nc1nc(Cl)nc2c1ncn2[C@@H]1O[C@H](COS(=O)(=O)NC(=…
|
| CHEMBL4208640 ChEMBL | P0A8L1 | 6.28 ~524.8 nM | 432.4 Da LogP -3.67 TPSA 225.1 | 2 viol. | ✓ Clean |
Nc1nccc2c1ncn2[C@@H]1O[C@H](COS(=O)(=O)NC(=O)[C…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1083817667 ZINC | 0.828 | 459.5 Da LogP -2.22 TPSA 217.8 | 1 viol. | ✓ Clean |
CC(C)C[C@@H](N)C(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n…
|
| ZINC936069053 ZINC | 0.828 | 459.5 Da LogP -2.22 TPSA 217.8 | 1 viol. | ✓ Clean |
CC(C)C[C@@H](N)C(=O)NS(=O)(=O)OC[C@@H]1O[C@H](n…
|
| ZINC168710640 ZINC | 0.815 | 474.5 Da LogP -4.00 TPSA 260.9 | 2 viol. | ✓ Clean |
NC(=O)CC[C@H](N)C(=O)NS(=O)(=O)OC[C@H]1O[C@@H](…
|
| ZINC168710738 ZINC | 0.815 | 474.5 Da LogP -4.00 TPSA 260.9 | 2 viol. | ✓ Clean |
NC(=O)CC[C@H](N)C(=O)NS(=O)(=O)OC[C@H]1O[C@@H](…
|
| ZINC936069043 ZINC | 0.773 | 459.5 Da LogP -2.22 TPSA 217.8 | 1 viol. | ✓ Clean |
CC[C@@H](C)[C@@H](N)C(=O)NS(=O)(=O)OC[C@@H]1O[C…
|
| ZINC14967098 ZINC | 0.762 | 403.4 Da LogP -3.64 TPSA 217.8 | 1 viol. | ✓ Clean |
NCC(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc…
|
| ZINC218033334 ZINC | 0.762 | 403.4 Da LogP -3.64 TPSA 217.8 | 1 viol. | ✓ Clean |
NCC(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc…
|
| ZINC218033425 ZINC | 0.762 | 403.4 Da LogP -3.64 TPSA 217.8 | 1 viol. | ✓ Clean |
NCC(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc…
|
| ZINC218033503 ZINC | 0.762 | 403.4 Da LogP -3.64 TPSA 217.8 | 1 viol. | ✓ Clean |
NCC(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc…
|
| ZINC12405780 ZINC | 0.700 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@@H]…
|
| ZINC12502832 ZINC | 0.700 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@@H]…
|
| ZINC79460727 ZINC | 0.700 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@H](…
|
| ZINC79460732 ZINC | 0.700 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@H](…
|
| ZINC61947659 ZINC | 0.661 | 323.3 Da LogP -2.74 TPSA 174.2 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](COS(=O)(=O)O)[C@@H](O)[C@H…
|
| ZINC31475423 ZINC | 0.657 | 434.3 Da LogP -2.99 TPSA 238.4 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO[P@@](=O)(O)OC(=O)…
|
| ZINC14967079 ZINC | 0.643 | 461.4 Da LogP -2.95 TPSA 258.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(=O)(=O)/N=C(\O)…
|
| ZINC24951137 ZINC | 0.623 | 417.4 Da LogP -2.41 TPSA 221.3 | 1 viol. | ✓ Clean |
C[C@H](N)/C(O)=N/S(=O)(=O)OC[C@H]1O[C@@H](n2cnc…
|
| ZINC13547650 ZINC | 0.619 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)…
|
| ZINC4823971 ZINC | 0.619 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](O…
|
| ZINC4823975 ZINC | 0.619 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](…
|
| ZINC4823980 ZINC | 0.619 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](O…
|
| ZINC4823984 ZINC | 0.619 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](…
|
| ZINC31260554 ZINC | 0.616 | 474.5 Da LogP -3.16 TPSA 264.4 | 2 viol. | ✓ Clean |
NC(=O)CC[C@H](N)/C(O)=N/S(=O)(=O)OC[C@H]1O[C@@H…
|
| ZINC31976683 ZINC | 0.616 | 474.5 Da LogP -3.16 TPSA 264.4 | 2 viol. | ✓ Clean |
NC(=O)CC[C@H](N)/C(O)=N/S(=O)(=O)OC[C@H]1O[C@@H…
|
| ZINC33821383 ZINC | 0.611 | 459.5 Da LogP -1.38 TPSA 221.3 | 1 viol. | ✓ Clean |
CC(C)C[C@H](N)/C(O)=N/S(=O)(=O)OC[C@H]1O[C@@H](…
|
| ZINC13518964 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@H](…
|
| ZINC1532515 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@H](O…
|
| ZINC1571045 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC1842158 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@H](O…
|
| ZINC2046931 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@H](…
|
| ZINC2126310 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3201891 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC3201893 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3830180 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3860156 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3977897 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](COP(=O)(O)O)[C@@H](O…
|
| ZINC4806442 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
| ZINC8613167 ZINC | 0.609 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
| ZINC1574270 ZINC | 0.609 | 421.4 Da LogP -0.26 TPSA 162.7 | 1 viol. | ✓ Clean |
Cc1ccc(S(=O)(=O)OC[C@@H]2O[C@H](n3cnc4c(N)ncnc4…
|
| ZINC3861767 ZINC | 0.609 | 421.4 Da LogP -0.26 TPSA 162.7 | 1 viol. | ✓ Clean |
Cc1ccc(S(=O)(=O)OC[C@H]2O[C@@H](n3cnc4c(N)ncnc4…
|
| ZINC13488353 ZINC | 0.597 | 459.5 Da LogP -1.38 TPSA 221.3 | 1 viol. | ✓ Clean |
CC[C@H](C)[C@H](N)/C(O)=N/S(=O)(=O)OC[C@H]1O[C@…
|
| ZINC5011204 ZINC | 0.594 | 295.3 Da LogP -1.80 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COC=O)[C@@H](O)[C@H…
|
| ZINC5011205 ZINC | 0.594 | 295.3 Da LogP -1.80 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COC=O)[C@@H](O)[C@…
|
| ZINC5011206 ZINC | 0.594 | 295.3 Da LogP -1.80 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COC=O)[C@@H](O)[C@@…
|
| ZINC5011208 ZINC | 0.594 | 295.3 Da LogP -1.80 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COC=O)[C@@H](O)[C@…
|
| ZINC5139067 ZINC | 0.593 | 283.3 Da LogP -1.04 TPSA 119.3 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CS)[C@@H](O)[C@H]1O
|
| ZINC49014951 ZINC | 0.588 | 416.4 Da LogP -2.76 TPSA 216.8 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CS(=O)(=O)CC[C@H](N)…
|
| ZINC49014955 ZINC | 0.588 | 416.4 Da LogP -2.76 TPSA 216.8 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CS(=O)(=O)CC[C@@H](N…
|
| ZINC17107643 ZINC | 0.585 | 345.3 Da LogP -1.93 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(N)(N)=O)[C@@H](…
|
| ZINC204538551 ZINC | 0.585 | 345.3 Da LogP -1.93 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(N)(N)=O)[C@@H](…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.