Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 4.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 55.102 Higher values support similarity to known essential genes.
- DEG E-value
- 2.5999999999999997e-54 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 93.38 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MVDSKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNAAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
5- GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0006524 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of alanine, 2-aminopropanoic acid.
- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
- GO:0043201 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a L-leucine stimulus.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 65 | Gene3D | G3DSA:1.10.10.10 | - |
| 1 | 65 | InterPro | IPR036388 | Winged helix-like DNA-binding domain superfamily |
| 13 | 61 | CDD | cd00090 | HTH_ARSR |
| 13 | 61 | InterPro | IPR011991 | ArsR-like helix-turn-helix domain |
| 10 | 158 | PANTHER | PTHR30154 | LEUCINE-RESPONSIVE REGULATORY PROTEIN |
| 12 | 73 | ProSiteProfiles | PS50956 | AsnC-type HTH domain profile. |
| 12 | 73 | InterPro | IPR000485 | AsnC-type HTH domain |
| 12 | 121 | SMART | SM00344 | asnc |
| 12 | 121 | InterPro | IPR019888 | Transcription regulator AsnC-like |
| 1 | 65 | FunFam | G3DSA:1.10.10.10:FF:000015 | Leucine-responsive transcriptional regulator Lrp |
| 12 | 28 | PRINTS | PR00033 | AsnC bacterial regulatory protein HTH signature |
| 12 | 28 | InterPro | IPR000485 | AsnC-type HTH domain |
| 28 | 39 | PRINTS | PR00033 | AsnC bacterial regulatory protein HTH signature |
| 28 | 39 | InterPro | IPR000485 | AsnC-type HTH domain |
| 39 | 58 | PRINTS | PR00033 | AsnC bacterial regulatory protein HTH signature |
| 39 | 58 | InterPro | IPR000485 | AsnC-type HTH domain |
| 65 | 149 | FunFam | G3DSA:3.30.70.920:FF:000001 | Transcriptional regulator, AsnC family |
| 12 | 70 | SUPERFAMILY | SSF46785 | Winged helix DNA-binding domain |
| 12 | 70 | InterPro | IPR036390 | Winged helix DNA-binding domain superfamily |
| 78 | 152 | Pfam | PF01037 | Lrp/AsnC ligand binding domain |
| 78 | 152 | InterPro | IPR019887 | Transcription regulator AsnC/Lrp, ligand binding domain |
| 30 | 56 | ProSitePatterns | PS00519 | AsnC-type HTH domain signature. |
| 30 | 56 | InterPro | IPR019885 | Transcription regulator HTH, AsnC-type, conserved site |
| 66 | 149 | Gene3D | G3DSA:3.30.70.920 | - |
| 12 | 59 | Pfam | PF13412 | Winged helix-turn-helix DNA-binding |
| 74 | 157 | SUPERFAMILY | SSF54909 | Dimeric alpha+beta barrel |
| 74 | 157 | InterPro | IPR011008 | Dimeric alpha-beta barrel |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GM90
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_1564
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Only proposed virtual-screening candidates are available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
No PDB ligands found through similar proteins.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC2390999 ZINC | 0.655 | 275.3 Da LogP -1.99 TPSA 172.8 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1605257 ZINC | 0.613 | 280.4 Da LogP 0.39 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)O
|
| ZINC1605258 ZINC | 0.613 | 280.4 Da LogP 0.39 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](NC(=O)[C@H](N)CCSC)C(=O)O
|
| ZINC1605259 ZINC | 0.613 | 280.4 Da LogP 0.39 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@H](CCSC)C(=O)O
|
| ZINC1605260 ZINC | 0.613 | 280.4 Da LogP 0.39 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@@H](N)C(=O)N[C@H](CCSC)C(=O)O
|
| ZINC3055005 ZINC | 0.591 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC3055007 ZINC | 0.591 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC3055010 ZINC | 0.591 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC2391099 ZINC | 0.586 | 274.3 Da LogP -2.59 TPSA 178.6 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)O
|
| ZINC2522597 ZINC | 0.586 | 246.3 Da LogP -0.60 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](NC(=O)C[C@H](N)C(=O)O)C(=O)O
|
| ZINC1569523 ZINC | 0.581 | 206.3 Da LogP -0.73 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@@H](N)C(=O)NCC(=O)O
|
| ZINC1593212 ZINC | 0.581 | 206.3 Da LogP -0.73 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)NCC(=O)O
|
| ZINC2384813 ZINC | 0.576 | 236.3 Da LogP -1.37 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CO)C(=O)O
|
| ZINC2384835 ZINC | 0.576 | 264.3 Da LogP -0.89 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CC(=O)O)C(=O)O
|
| ZINC2390943 ZINC | 0.576 | 248.3 Da LogP 0.29 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@H](C(=O)O)C(C)C
|
| ZINC4557150 ZINC | 0.576 | 236.3 Da LogP -1.37 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@H](CO)C(=O)O
|
| ZINC4899465 ZINC | 0.576 | 411.6 Da LogP 0.63 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCSC…
|
| ZINC64219373 ZINC | 0.576 | 411.6 Da LogP 0.63 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@H](CCSC)…
|
| ZINC1532219 ZINC | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)O
|
| ZINC1532220 ZINC | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](NC(=O)[C@H](N)CC(C)C)C(=O)O
|
| ZINC1532221 ZINC | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
|
| ZINC1532222 ZINC | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
|
| ZINC7997269 ZINC | 0.571 | 205.3 Da LogP 0.07 TPSA 99.2 | ✓ Ro5 | ✓ Clean |
CSC(=N)NCCC[C@@H](N)C(=O)O
|
| ZINC11755051 ZINC | 0.567 | 204.3 Da LogP 0.94 TPSA 46.3 | ✓ Ro5 | ✓ Clean |
CCN(CC)C(=O)[C@@H](N)CCSC
|
| ZINC57358674 ZINC | 0.567 | 205.3 Da LogP 1.41 TPSA 52.3 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)OC(C)(C)C
|
| ZINC57933694 ZINC | 0.567 | 205.3 Da LogP 1.41 TPSA 52.3 | ✓ Ro5 | ✓ Clean |
CSCC[C@@H](N)C(=O)OC(C)(C)C
|
| ZINC62725402 ZINC | 0.567 | 204.3 Da LogP 0.94 TPSA 46.3 | ✓ Ro5 | ✓ Clean |
CCN(CC)C(=O)[C@H](N)CCSC
|
| ZINC1555366 ZINC | 0.565 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1555367 ZINC | 0.565 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1555369 ZINC | 0.565 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1720127 ZINC | 0.565 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1720128 ZINC | 0.565 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1720130 ZINC | 0.565 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC19796052 ZINC | 0.553 | 219.2 Da LogP -1.73 TPSA 156.9 | ✓ Ro5 | ✓ Clean |
N/C(=N\[N+](=O)[O-])NCCC[C@H](N)C(=O)O
|
| ZINC21982226 ZINC | 0.553 | 219.2 Da LogP -1.73 TPSA 156.9 | ✓ Ro5 | ✓ Clean |
N/C(=N\[N+](=O)[O-])NCCC[C@@H](N)C(=O)O
|
| ZINC1581634 ZINC | 0.552 | 203.2 Da LogP -2.22 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@H](N)C(=O)NCC(=O)O
|
| ZINC1605717 ZINC | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@H](C(=O)O)C(C)C
|
| ZINC1605718 ZINC | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@H](C(=O)O)C(C)C
|
| ZINC1605719 ZINC | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](C(=O)O)C(C)C
|
| ZINC1605720 ZINC | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@@H](C(=O)O)C(C)C
|
| ZINC5500823 ZINC | 0.552 | 203.2 Da LogP -2.22 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@@H](N)C(=O)NCC(=O)O
|
| ZINC2390945 ZINC | 0.543 | 262.4 Da LogP 0.68 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)O
|
| ZINC2516118 ZINC | 0.543 | 278.3 Da LogP -0.50 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@@H](CCC(=O)O)C(=O)O
|
| ZINC4557160 ZINC | 0.543 | 262.4 Da LogP 0.68 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@@H](N)C(=O)N[C@@H](CC(C)C)C(=O)O
|
| ZINC4557161 ZINC | 0.543 | 262.4 Da LogP 0.68 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
|
| ZINC4557162 ZINC | 0.543 | 262.4 Da LogP 0.68 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
|
| ZINC1541834 ZINC | 0.533 | 218.3 Da LogP -1.08 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)O
|
| ZINC2556618 ZINC | 0.533 | 246.3 Da LogP -0.60 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CC(=O)O)C(=O)O
|
| ZINC4556665 ZINC | 0.533 | 357.5 Da LogP 1.51 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](…
|
| ZINC4556684 ZINC | 0.533 | 218.3 Da LogP -1.08 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@@H](CO)C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.