KpATCC43816 Protein target profile

alpha-L-glutamate ligase, RimK family protein

Accession: VK055_1606

Gene: AIK80226.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GM45
Length 300
Pocket druggability (P2Rank · AlphaFold DB model) 0.891
Direct ligand evidence 0 52 total records
Functional annotation 0 EC 3 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
31.884 Lower values reduce human off-target concern.
Human E-value
2.26e-17
Gut microbiome similarity
2.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
44.631 Higher values support similarity to known essential genes.
DEG E-value
1.22e-87 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
90.95 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.891
Structure A0A0H3GM45
Pocket Pocket 1
Druggability (FPocket) 0.768
Structure A0A0H3GM45
Pocket Pocket 5
ColabFold model
P2Rank 0.921 · Pocket 1
FPocket 0.927 · Pocket 1
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 113 / 4744 genomes with a hit
Prevalence 2.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MKIAILSRDGTLYSCRRLREAAQQRGHQIEILDPLSCYMNVSPVASSIHYKGRQLPHFDAVIPRIGSAITYYGTAALRQFELLGSYPLNESVAITRARDKLRSLQLLARQGIDLPLTGIAHSPDDTSDLIAMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVIDAFRGLNAHILVQEYIAEAKGCDIRCLVVGNEVVAAIERRAKEGDFRSNLHRGGMATVAQISDEERAIAIKATQTLGLDAAGVDILRAARGPLVMEVNASPGLEGVETTTGVDVAGKMIAWIERQATPEFCLKIGG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

3
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0036211 The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications). Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
  • GO:0046872 Binding to a metal ion.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
115 180 FunFam G3DSA:3.30.1490.20:FF:000005 Probable alpha-L-glutamate ligase 1
1 114 Gene3D G3DSA:3.40.50.20 -
104 287 ProSiteProfiles PS50975 ATP-grasp fold profile.
104 287 InterPro IPR011761 ATP-grasp fold
181 300 FunFam G3DSA:3.30.470.20:FF:000016 Ribosomal protein S6--L-glutamate ligase
2 286 NCBIfam TIGR00768 RimK family alpha-L-glutamate ligase
2 286 InterPro IPR004666 Ribosomal S6 modification enzyme RimK/Lysine biosynthesis enzyme LysX
115 180 Gene3D G3DSA:3.30.1490.20 -
115 180 InterPro IPR013815 ATP-grasp fold, subdomain 1
1 113 FunFam G3DSA:3.40.50.20:FF:000004 Probable alpha-L-glutamate ligase
97 286 Pfam PF08443 RimK-like ATP-grasp domain
97 286 InterPro IPR013651 ATP-grasp fold, RimK-type
1 295 Hamap MF_01552 Ribosomal protein S6--L-glutamate ligase [rimK].
1 295 InterPro IPR023533 Ribosomal protein S6--L-glutamate ligase RimK
181 299 Gene3D G3DSA:3.30.470.20 -
1 94 Pfam PF18030 RimK PreATP-grasp domain
1 94 InterPro IPR041107 RimK, PreATP-grasp domain
1 289 PANTHER PTHR21621 RIBOSOMAL PROTEIN S6 MODIFICATION PROTEIN
98 288 SUPERFAMILY SSF56059 Glutathione synthetase ATP-binding domain-like

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.891
Likely same site as FPocket 15 0.8 Å 38 shared residues 95% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.008
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #5
0.768
Show in viewer
Surrounding area
Pocket 2 FPocket #15
0.732 Unusual size
Likely same site as P2Rank 1 0.8 Å 38 shared residues 95% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:141-141
UniProt: Binding site:178-179
UniProt: Binding site:187-187
UniProt: Binding site:211-213
UniProt: Binding site:248-248
UniProt: Binding site:260-260
UniProt: Binding site:262-262
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GM45
AlphaFold DB full sequence Viewing
ColabFold VK055_1606
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
ANP PDB via homolog 506.2 Da · LogP -2.06 · TPSA 281.9 Open detail RCSB PDB
BUA PDB via homolog Detail RCSB PDB
ZINC12360002 ZINC proposed compound · Tanimoto 0.810 Detail ZINC
ZINC12360703 ZINC proposed compound · Tanimoto 0.810 Detail ZINC
ZINC12503599 ZINC proposed compound · Tanimoto 0.810 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ANP RCSB PDB A6G4D7 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
BUA RCSB PDB Q5SH23 88.1 Da LogP 0.87 TPSA 37.3 ✓ Ro5 ✓ Clean CCCC(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.