KpATCC43816 Protein target profile

putative methyltransferase, enzyme of biotin synthesis

Accession: VK055_1729

Gene: AIK80349.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GQ67
Length 251
Pocket druggability (P2Rank · AlphaFold DB model) 0.956
Direct ligand evidence 0 52 total records
Functional annotation 1 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
25.309 Lower values reduce human off-target concern.
Human E-value
1.96e-09
Gut microbiome similarity
1.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
39.231 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
91.32 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.956
Structure A0A0H3GQ67
Pocket Pocket 1
Druggability (FPocket) 0.828
Structure A0A0H3GQ67
Pocket Pocket 4
ColabFold model
P2Rank 0.927 · Pocket 1
FPocket 0.814 · Pocket 2
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 85 / 4744 genomes with a hit
Prevalence 1.8%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MATVNKQAVAAAFGRAASGYTQHDELQRRCADLLLRQLARRDFAQVLDAGCGPGSMSRYWREAGSVVTALDLSAGMLAQAQRNDAAQHYLLGDIEALPLPDACVDLTWSNLAVQWCDDLRAAIGELYRVARPGGRVAFSTLLADSLPELNQAWQAIDDRPHANRFLSEAAVRAALSGLRATGEVHQISLPFADALSAMRSLKGIGATHLHQGRTAAPLGRGKLRELQLAWPQRQGICPLTYSLFTGVIERD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Subcellular localization

Localization
Unknown

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0008168 Catalysis of the transfer of a methyl group to an acceptor molecule.
  • GO:0009102 The chemical reactions and pathways resulting in the formation of biotin, cis-tetrahydro-2-oxothieno(3,4-d)imidazoline-4-valeric acid.
  • GO:0010340 Catalysis of the transfer of a methyl group to the carboxyl group of an acceptor molecule to form a methyl ester.
  • GO:0102130 Catalysis of the reaction: S-adenosyl-L-methionine + a malonyl-[acp] = S-adenosyl-L-homocysteine + a malonyl-[acp] methyl ester.
  • GO:0008757 Catalysis of the transfer of a methyl group from S-adenosyl-L-methionine to a substrate.
  • GO:0032259 The process in which a methyl group is covalently attached to a molecule.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

12 records
Show feature table
Start End DB Term Name
4 250 Hamap MF_00835 Malonyl-[acyl-carrier protein] O-methyltransferase [bioC].
4 250 InterPro IPR011814 Malonyl-[acyl-carrier protein] O-methyltransferase BioC
46 143 CDD cd02440 AdoMet_MTases
17 174 PANTHER PTHR43591 METHYLTRANSFERASE
47 138 Pfam PF08241 Methyltransferase domain
47 138 InterPro IPR013216 Methyltransferase type 11
11 208 Gene3D G3DSA:3.40.50.150 Vaccinia Virus protein VP39
11 208 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
10 178 SUPERFAMILY SSF53335 S-adenosyl-L-methionine-dependent methyltransferases
10 178 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
12 249 NCBIfam TIGR02072 malonyl-ACP O-methyltransferase BioC
12 249 InterPro IPR011814 Malonyl-[acyl-carrier protein] O-methyltransferase BioC

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.956
Likely same site as FPocket 4 5.7 Å 16 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.258
Likely same site as FPocket 15 2.9 Å 16 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.024
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.018
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #4
0.828
Likely same site as P2Rank 1 5.7 Å 16 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #15
0.226 Unusual size
Likely same site as P2Rank 2 2.9 Å 16 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GQ67
AlphaFold DB full sequence Viewing
ColabFold VK055_1729
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
BEZ PDB via homolog 122.1 Da · LogP 1.38 · TPSA 37.3 Open detail RCSB PDB
TEX PDB via homolog Detail RCSB PDB
ZINC2383097 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC31333229 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC3873176 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
BEZ RCSB PDB Q3MEY9 122.1 Da LogP 1.38 TPSA 37.3 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)O
TEX RCSB PDB A0A077K7L1 437.6 Da LogP 4.85 TPSA 68.4 ✓ Ro5 Alert CC(C)[C@H]1C(=O)N[C@@H](Cc2c[nH]c3c2c(ccc3[C@](…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.