Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 58.103 Lower values reduce human off-target concern.
- Human E-value
- 3.47e-101
- Gut microbiome similarity
- 25.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 59.677 Higher values support similarity to known essential genes.
- DEG E-value
- 1.01e-111 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 96.0 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKAEGFSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVIIAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNAEEIAAKAAAVANQGKAK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
5- GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
- GO:0006096 The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.
- GO:0016868 Catalysis of the transfer of a phosphate group from one position to another within a single molecule.
- GO:0004619 Catalysis of the reaction: (2R)-2-phosphoglycerate = (2R)-3-phosphoglycerate.
- GO:0006094 The formation of glucose from noncarbohydrate precursors, such as pyruvate, amino acids and glycerol.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 5 | 230 | InterPro | IPR013078 | Histidine phosphatase superfamily, clade-1 |
| 4 | 248 | PANTHER | PTHR11931 | PHOSPHOGLYCERATE MUTASE |
| 4 | 248 | InterPro | IPR005952 | Phosphoglycerate mutase 1 |
| 3 | 116 | PIRSF | PIRSF000709 | 6PFK_fruc_bisph_Ptase |
| 167 | 239 | PIRSF | PIRSF000709 | 6PFK_fruc_bisph_Ptase |
| 3 | 230 | Hamap | MF_01039 | 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [gpmA]. |
| 3 | 230 | InterPro | IPR005952 | Phosphoglycerate mutase 1 |
| 2 | 250 | Gene3D | G3DSA:3.40.50.1240 | - |
| 2 | 250 | InterPro | IPR029033 | Histidine phosphatase superfamily |
| 2 | 250 | FunFam | G3DSA:3.40.50.1240:FF:000003 | 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase |
| 6 | 221 | Pfam | PF00300 | Histidine phosphatase superfamily (branch 1) |
| 6 | 221 | InterPro | IPR013078 | Histidine phosphatase superfamily, clade-1 |
| 4 | 247 | SUPERFAMILY | SSF53254 | Phosphoglycerate mutase-like |
| 4 | 247 | InterPro | IPR029033 | Histidine phosphatase superfamily |
| 5 | 230 | CDD | cd07067 | HP_PGM_like |
| 5 | 248 | NCBIfam | TIGR01258 | 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase |
| 5 | 248 | InterPro | IPR005952 | Phosphoglycerate mutase 1 |
| 8 | 17 | ProSitePatterns | PS00175 | Phosphoglycerate mutase family phosphohistidine signature. |
| 8 | 17 | InterPro | IPR001345 | Phosphoglycerate/bisphosphoglycerate mutase, active site |
| 5 | 191 | SMART | SM00855 | PGAM_5 |
| 5 | 191 | InterPro | IPR013078 | Histidine phosphatase superfamily, clade-1 |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GU79
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_1767
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 3PG RCSB PDB | Q3JWH7 | 186.1 Da LogP -1.46 TPSA 124.3 | ✓ Ro5 | ✓ Clean |
C([C@H](C(=O)O)O)OP(=O)(O)O
|
|
| 9JF RCSB PDB | P18669 | 411.4 Da LogP 2.38 TPSA 141.0 | ✓ Ro5 | Alert |
c1ccc2c(c1)C(=O)c3cc(c(c(c3C2=O)O)O)NS(=O)(=O)c…
|
|
| AZN RCSB PDB | P18669 | 320.3 Da LogP 1.12 TPSA 129.0 | ✓ Ro5 | Alert |
c1ccc2c(c1)C(=O)c3cc(c(c(c3C2=O)O)O)S(=O)(=O)O
|
|
| MLI RCSB PDB | Q3JWH7 | 102.0 Da LogP -3.12 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(=O)[O-]
|
|
| PG6 RCSB PDB | Q3JWH7 | 266.3 Da LogP 0.35 TPSA 55.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOC
|
|
| PO3 RCSB PDB | Q3JWH7 | 79.0 Da LogP -1.64 TPSA 63.2 | ✓ Ro5 | ✓ Clean |
[O-][P-](=O)[O-]
|
|
| SEP RCSB PDB | Q3JWH7 | 185.1 Da LogP -1.49 TPSA 130.1 | ✓ Ro5 | ✓ Clean |
C([C@@H](C(=O)O)N)OP(=O)(O)O
|
|
| TLA RCSB PDB | B4RIY7 | 150.1 Da LogP -2.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
[C@@H]([C@H](C(=O)O)O)(C(=O)O)O
|
|
| VO4 RCSB PDB | Q3JWH7 | 114.9 Da LogP -3.69 TPSA 86.2 | ✓ Ro5 | ✓ Clean |
[O-][V](=O)([O-])[O-]
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| DWT ChEMBL | P18669 | 7.30 ~50.1 nM | 503.5 Da LogP 5.75 TPSA 97.6 | 2 viol. | ✓ Clean |
Cc1ccc(cc1Nc2c3cn(nc3nc(n2)c4cccnc4)C)C(=O)Nc5c…
|
| CHEMBL4760337 ChEMBL | P18669 | 7.01 ~97.7 nM | 477.5 Da LogP 4.72 TPSA 120.8 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(NS(=O)(=O)c1ccc(C3CCCCC…
|
| CHEMBL5270603 ChEMBL | P18669 | 6.98 ~104.7 nM | 464.5 Da LogP 3.27 TPSA 124.0 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(NS(=O)(=O)c1ccc(N3CCCC3…
|
| CHEMBL4763924 ChEMBL | P18669 | 6.85 ~141.3 nM | 505.9 Da LogP 4.99 TPSA 120.8 | 1 viol. | Alert |
O=C1c2ccccc2C(=O)c2c1cc(NS(=O)(=O)c1ccc(-c3ccc(…
|
| CHEMBL4789955 ChEMBL | P18669 | 6.72 ~190.5 nM | 445.5 Da LogP 3.83 TPSA 120.8 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(NS(=O)(=O)c1ccc3ccccc3c…
|
| CHEMBL4741748 ChEMBL | P18669 | 6.60 ~251.2 nM | 471.5 Da LogP 4.34 TPSA 120.8 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(NS(=O)(=O)c1ccc(-c3cccc…
|
| CHEMBL4784572 ChEMBL | P18669 | 6.58 ~263.0 nM | 489.5 Da LogP 4.48 TPSA 120.8 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(NS(=O)(=O)c1ccc(-c3ccc(…
|
| AW6 ChEMBL | P18669 | 6.57 ~269.2 nM | 429.8 Da LogP 3.33 TPSA 120.8 | ✓ Ro5 | Alert |
c1ccc2c(c1)C(=O)c3cc(c(c(c3C2=O)O)O)NS(=O)(=O)c…
|
| CHEMBL4742013 ChEMBL | P18669 | 6.48 ~331.1 nM | 478.5 Da LogP 3.66 TPSA 124.0 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(NS(=O)(=O)c1ccc(N3CCCCC…
|
| 8LF ChEMBL | P18669 | 6.44 ~363.1 nM | 409.4 Da LogP 2.98 TPSA 120.8 | ✓ Ro5 | Alert |
Cc1ccc(cc1)S(=O)(=O)Nc2cc3c(c(c2O)O)C(=O)c4cccc…
|
| CHEMBL4759807 ChEMBL | P18669 | 6.32 ~478.6 nM | 425.4 Da LogP 2.68 TPSA 130.0 | ✓ Ro5 | Alert |
COc1cccc(S(=O)(=O)Nc2cc3c(c(O)c2O)C(=O)c2ccccc2…
|
| CHEMBL4752163 ChEMBL | P18669 | 6.31 ~489.8 nM | 451.5 Da LogP 3.97 TPSA 120.8 | ✓ Ro5 | Alert |
CC(C)(C)c1ccc(S(=O)(=O)Nc2cc3c(c(O)c2O)C(=O)c2c…
|
| CHEMBL5277511 ChEMBL | P18669 | 6.31 ~489.8 nM | 456.4 Da LogP 2.84 TPSA 177.1 | 1 viol. | Alert |
Cc1cc([C@H]2Oc3cc(O)cc(O)c3C[C@H]2OC(=O)c2cc(O)…
|
| KDH ChEMBL | P18669 | 6.31 ~489.8 nM | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
c1c(cc(c(c1O)O)O)[C@@H]2[C@@H](Cc3c(cc(cc3O2)O)…
|
| CHEMBL186784 ChEMBL | P18669 | 6.30 ~501.2 nM | 196.2 Da LogP 2.95 TPSA 30.2 | ✓ Ro5 | ✓ Clean |
O=c1c2ccccc2oc2ccccc12
|
| CHEMBL4228862 ChEMBL | P18669 | 6.30 ~501.2 nM | 481.5 Da LogP 4.91 TPSA 137.1 | ✓ Ro5 | Alert |
O=c1c2c(O)cccc2oc2cc(NS(=O)(=O)c3ccc(C4CCCCC4)c…
|
| CHEMBL4743623 ChEMBL | P18669 | 6.26 ~549.5 nM | 435.9 Da LogP 3.39 TPSA 120.8 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(NS(=O)(=O)c1ccc(Cl)s1)c…
|
| CHEMBL4798515 ChEMBL | P18669 | 6.26 ~549.5 nM | 497.8 Da LogP 4.35 TPSA 120.8 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(NS(=O)(=O)c1ccc(Cl)c(C(…
|
| CHEMBL4762201 ChEMBL | P18669 | 6.20 ~631.0 nM | 481.4 Da LogP 3.83 TPSA 120.8 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(NS(=O)(=O)c1ccc(F)c(C(F…
|
| HKB ChEMBL | P18669 | 6.11 ~776.2 nM | 438.5 Da LogP 2.74 TPSA 124.0 | ✓ Ro5 | Alert |
CN(C)c1ccc(cc1)S(=O)(=O)Nc2cc3c(c(c2O)O)C(=O)c4…
|
| CHEMBL4787732 ChEMBL | P18669 | 6.08 ~831.8 nM | 401.4 Da LogP 2.74 TPSA 120.8 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(NS(=O)(=O)c1cccs1)c(O)c…
|
| CHEMBL5290046 ChEMBL | P18669 | 6.07 ~851.1 nM | 450.5 Da LogP 2.88 TPSA 124.0 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(NS(=O)(=O)c1ccc(N3CCC3)…
|
| 9HU ChEMBL | P18669 | 6.00 ~1.0 µM | 453.4 Da LogP 2.60 TPSA 147.1 | ✓ Ro5 | Alert |
CC(=O)Oc1ccccc1S(=O)(=O)Nc2cc3c(c(c2O)O)C(=O)c4…
|
| CHEMBL4227227 ChEMBL | P18669 | 6.00 ~1.0 µM | 482.5 Da LogP 3.85 TPSA 140.3 | ✓ Ro5 | Alert |
O=c1c2c(O)cccc2oc2cc(NS(=O)(=O)c3ccc(N4CCCCC4)c…
|
| 8KX ChEMBL | Q9DBJ1 | — | 463.4 Da LogP 3.69 TPSA 120.8 | ✓ Ro5 | Alert |
c1ccc2c(c1)C(=O)c3cc(c(c(c3C2=O)O)O)S(=O)(=O)Nc…
|
| CHEMBL175336 ChEMBL | Q9DBJ1 | — | 342.3 Da LogP -2.22 TPSA 131.8 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(S(=O)(=O)[O-])c(O)c2O.[…
|
| CHEMBL55814 ChEMBL | Q9DBJ1 | — | 240.2 Da LogP 1.87 TPSA 74.6 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1ccc(O)c2O
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1692489 ZINC | 1.000 | 222.3 Da LogP 0.33 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOC
|
| ZINC3860973 ZINC | 1.000 | 240.2 Da LogP 1.87 TPSA 74.6 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1ccc(O)c2O
|
| ZINC4530388 ZINC | 1.000 | 266.3 Da LogP 0.35 TPSA 55.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOC
|
| ZINC5701172 ZINC | 1.000 | 310.4 Da LogP 0.36 TPSA 64.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOC
|
| ZINC5997861 ZINC | 1.000 | 398.5 Da LogP 0.40 TPSA 83.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOC
|
| ZINC72194202 ZINC | 1.000 | 463.4 Da LogP 3.69 TPSA 120.8 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(S(=O)(=O)Nc1ccc(C(F)(F)…
|
| ZINC3870412 ZINC | 0.872 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1cc(O)c(O)c…
|
| ZINC3870413 ZINC | 0.872 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@H]1c1cc(O)c(O)c(…
|
| ZINC3870414 ZINC | 0.872 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1cc(O)c(O)c(…
|
| ZINC3870415 ZINC | 0.872 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@H]1c1cc(O)c(O)c(O…
|
| ZINC14436185 ZINC | 0.792 | 472.4 Da LogP 2.54 TPSA 186.4 | 2 viol. | Alert |
COc1cc(C(=O)O[C@@H]2Cc3c(O)cc(O)cc3O[C@@H]2c2cc…
|
| ZINC5699362 ZINC | 0.778 | 256.2 Da LogP 1.58 TPSA 94.8 | ✓ Ro5 | Alert |
O=C1c2ccc(O)c(O)c2C(=O)c2cccc(O)c21
|
| ZINC3978503 ZINC | 0.755 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1ccc(O)c(O)…
|
| ZINC4534390 ZINC | 0.755 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1ccc(O)c(O)c…
|
| ZINC4544252 ZINC | 0.755 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@H]1c1ccc(O)c(O)c1…
|
| ZINC8681494 ZINC | 0.755 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@H]1c1ccc(O)c(O)c…
|
| ZINC14727965 ZINC | 0.750 | 426.4 Da LogP 2.82 TPSA 156.9 | 1 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1ccc(O)cc1)…
|
| ZINC1713880 ZINC | 0.739 | 224.2 Da LogP 2.31 TPSA 47.3 | ✓ Ro5 | ✓ Clean |
O=c1oc2ccccc2c(=O)c2ccccc12
|
| ZINC34764844 ZINC | 0.733 | 206.3 Da LogP 1.09 TPSA 36.9 | ✓ Ro5 | ✓ Clean |
CCCOCCOCCOCCOC
|
| ZINC3875857 ZINC | 0.714 | 320.3 Da LogP 1.12 TPSA 129.0 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c1cc(S(=O)(=O)O)c(O)c2O
|
| ZINC3874832 ZINC | 0.704 | 272.2 Da LogP 1.28 TPSA 115.1 | ✓ Ro5 | Alert |
O=C1c2ccc(O)c(O)c2C(=O)c2c(O)ccc(O)c21
|
| ZINC1532902 ZINC | 0.700 | 206.2 Da LogP -0.86 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CC[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC2018106 ZINC | 0.700 | 206.2 Da LogP -0.86 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CC[C@](O)(CC(=O)O)C(=O)O
|
| ZINC3870461 ZINC | 0.700 | 256.2 Da LogP 1.58 TPSA 94.8 | ✓ Ro5 | Alert |
O=C1c2ccc(O)cc2C(=O)c2c1ccc(O)c2O
|
| ZINC4783172 ZINC | 0.700 | 478.4 Da LogP 3.73 TPSA 149.2 | ✓ Ro5 | Alert |
O=C1c2ccc(-c3ccc4c(c3)C(=O)c3c(ccc(O)c3O)C4=O)c…
|
| ZINC5699358 ZINC | 0.700 | 256.2 Da LogP 1.58 TPSA 94.8 | ✓ Ro5 | Alert |
O=C1c2cc(O)ccc2C(=O)c2c1ccc(O)c2O
|
| ZINC71404891 ZINC | 0.694 | 318.3 Da LogP 1.28 TPSA 108.7 | ✓ Ro5 | Alert |
CS(=O)(=O)c1cc2c(c(O)c1O)C(=O)c1ccccc1C2=O
|
| ZINC12359024 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC13533920 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC1532740 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC1549593 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC2013424 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC3581021 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC3860635 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC5783661 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC6072527 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC140264883 ZINC | 0.688 | 223.3 Da LogP -0.43 TPSA 72.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCON
|
| ZINC143705779 ZINC | 0.688 | 443.5 Da LogP -0.34 TPSA 118.3 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCON
|
| ZINC1580161 ZINC | 0.688 | 208.3 Da LogP -0.33 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCO
|
| ZINC16052257 ZINC | 0.688 | 384.5 Da LogP -0.26 TPSA 94.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC33358855 ZINC | 0.688 | 207.3 Da LogP -0.36 TPSA 62.9 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCN
|
| ZINC34317654 ZINC | 0.688 | 472.6 Da LogP -0.23 TPSA 112.5 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC44583772 ZINC | 0.688 | 356.5 Da LogP 0.66 TPSA 64.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCS
|
| ZINC575432090 ZINC | 0.688 | 355.4 Da LogP -0.38 TPSA 99.9 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCON
|
| ZINC5997860 ZINC | 0.688 | 296.4 Da LogP -0.29 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCO
|
| ZINC71254563 ZINC | 0.688 | 488.6 Da LogP 0.71 TPSA 92.3 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCS
|
| ZINC80685077 ZINC | 0.688 | 427.5 Da LogP -0.28 TPSA 109.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCN
|
| ZINC83253930 ZINC | 0.688 | 224.3 Da LogP 0.61 TPSA 36.9 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCS
|
| ZINC90556287 ZINC | 0.688 | 268.4 Da LogP 0.63 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCS
|
| ZINC96503353 ZINC | 0.688 | 471.6 Da LogP -0.26 TPSA 118.3 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCN
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.