KpATCC43816 Protein target profile

phosphoglyceromutase 1

Accession: VK055_1767

Gene: gpmA AIK80387.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GU79
Length 250
Pocket druggability (P2Rank · AlphaFold DB model) 0.808
Direct ligand evidence 0 86 total records
Functional annotation 1 EC 5 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
58.103 Lower values reduce human off-target concern.
Human E-value
3.47e-101
Gut microbiome similarity
25.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
59.677 Higher values support similarity to known essential genes.
DEG E-value
1.01e-111 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
96.0 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.808
Structure A0A0H3GU79
Pocket Pocket 1
Druggability (FPocket) 0.181
Structure A0A0H3GU79
Pocket Pocket 4
ColabFold model
P2Rank 0.766 · Pocket 1
FPocket 0.232 · Pocket 4
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 1226 / 4744 genomes with a hit
Prevalence 25.8%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKAEGFSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVIIAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNAEEIAAKAAAVANQGKAK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
  • GO:0006096 The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.
  • GO:0016868 Catalysis of the transfer of a phosphate group from one position to another within a single molecule.
  • GO:0004619 Catalysis of the reaction: (2R)-2-phosphoglycerate = (2R)-3-phosphoglycerate.
  • GO:0006094 The formation of glucose from noncarbohydrate precursors, such as pyruvate, amino acids and glycerol.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

21 records
Show feature table
Start End DB Term Name
5 230 InterPro IPR013078 Histidine phosphatase superfamily, clade-1
4 248 PANTHER PTHR11931 PHOSPHOGLYCERATE MUTASE
4 248 InterPro IPR005952 Phosphoglycerate mutase 1
3 116 PIRSF PIRSF000709 6PFK_fruc_bisph_Ptase
167 239 PIRSF PIRSF000709 6PFK_fruc_bisph_Ptase
3 230 Hamap MF_01039 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [gpmA].
3 230 InterPro IPR005952 Phosphoglycerate mutase 1
2 250 Gene3D G3DSA:3.40.50.1240 -
2 250 InterPro IPR029033 Histidine phosphatase superfamily
2 250 FunFam G3DSA:3.40.50.1240:FF:000003 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
6 221 Pfam PF00300 Histidine phosphatase superfamily (branch 1)
6 221 InterPro IPR013078 Histidine phosphatase superfamily, clade-1
4 247 SUPERFAMILY SSF53254 Phosphoglycerate mutase-like
4 247 InterPro IPR029033 Histidine phosphatase superfamily
5 230 CDD cd07067 HP_PGM_like
5 248 NCBIfam TIGR01258 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
5 248 InterPro IPR005952 Phosphoglycerate mutase 1
8 17 ProSitePatterns PS00175 Phosphoglycerate mutase family phosphohistidine signature.
8 17 InterPro IPR001345 Phosphoglycerate/bisphosphoglycerate mutase, active site
5 191 SMART SM00855 PGAM_5
5 191 InterPro IPR013078 Histidine phosphatase superfamily, clade-1

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.808
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.052
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:11-11 Tele-phosphohistidine intermediate
UniProt: Active site:89-89 Proton donor/acceptor
UniProt: Binding site:10-17
UniProt: Binding site:100-100
UniProt: Binding site:116-117
UniProt: Binding site:185-186
UniProt: Binding site:23-24
UniProt: Binding site:62-62
UniProt: Binding site:89-92
UniProt: Site:184-184 Transition state stabilizer
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GU79
AlphaFold DB full sequence Viewing
ColabFold VK055_1767
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

86 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 36 records from similar proteins
Structural ligands 9 0 loaded crystals
Measured bioactivity 27 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
3PG PDB via homolog 186.1 Da · LogP -1.46 · TPSA 124.3 Open detail RCSB PDB
9JF PDB via homolog Detail RCSB PDB
AZN PDB via homolog Detail RCSB PDB
MLI PDB via homolog Detail RCSB PDB
PG6 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
3PG RCSB PDB Q3JWH7 186.1 Da LogP -1.46 TPSA 124.3 ✓ Ro5 ✓ Clean C([C@H](C(=O)O)O)OP(=O)(O)O
9JF RCSB PDB P18669 411.4 Da LogP 2.38 TPSA 141.0 ✓ Ro5 Alert c1ccc2c(c1)C(=O)c3cc(c(c(c3C2=O)O)O)NS(=O)(=O)c…
AZN RCSB PDB P18669 320.3 Da LogP 1.12 TPSA 129.0 ✓ Ro5 Alert c1ccc2c(c1)C(=O)c3cc(c(c(c3C2=O)O)O)S(=O)(=O)O
MLI RCSB PDB Q3JWH7 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
PG6 RCSB PDB Q3JWH7 266.3 Da LogP 0.35 TPSA 55.4 ✓ Ro5 ✓ Clean COCCOCCOCCOCCOCCOC
PO3 RCSB PDB Q3JWH7 79.0 Da LogP -1.64 TPSA 63.2 ✓ Ro5 ✓ Clean [O-][P-](=O)[O-]
SEP RCSB PDB Q3JWH7 185.1 Da LogP -1.49 TPSA 130.1 ✓ Ro5 ✓ Clean C([C@@H](C(=O)O)N)OP(=O)(O)O
TLA RCSB PDB B4RIY7 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@@H]([C@H](C(=O)O)O)(C(=O)O)O
VO4 RCSB PDB Q3JWH7 114.9 Da LogP -3.69 TPSA 86.2 ✓ Ro5 ✓ Clean [O-][V](=O)([O-])[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.