KpATCC43816 Protein target profile

thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein

Accession: VK055_1942

Gene: AIK80548.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A1W1QTK6
Length 276
Pocket druggability (P2Rank · AlphaFold DB model) 0.812
Direct ligand evidence 0 106 total records
Functional annotation 1 EC 1 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
39.423 Lower values reduce human off-target concern.
Human E-value
4.17e-15
Gut microbiome similarity
1.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
31.418 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
97.3 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.812
Structure A0A1W1QTK6
Pocket Pocket 1
Druggability (FPocket) 0.426
Structure A0A1W1QTK6
Pocket Pocket 7
ColabFold model
P2Rank 0.792 · Pocket 1
FPocket 0.714 · Pocket 2
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 50 / 4744 genomes with a hit
Prevalence 1.1%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MNPFSLSVKELEQKARAIRRRIIVLNAESPAGGHTGADLSQVELLTALYFRILNCSPARKESDDRDIYIQSKGHAVGGYYCVLAEAGFIPVDWLATYQHADSALPGHPVKHKTPGIELNTGALGHGLPVAVGIALAAKRDNNPRRVFVVTGDGELAEGSNWEAALVAAHYQLDNLIIINDKNNLQLAGATKEIMNTDPLDEKWRAFGMEVTQCNGNDMAEVVATLERLQPNGKPHVVIANTTKGAGISFIQGRPEWHHRVPKGEEIELALEELKDE

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 1 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

1
  • GO:0004802 Catalysis of the reversible transfer of a 2-carbon ketol group (CH2OH-CO-) from a ketose phosphate donor to an aldose phosphate acceptor.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

9 records
Show feature table
Start End DB Term Name
23 268 Pfam PF00456 Transketolase, thiamine diphosphate binding domain
23 268 InterPro IPR005474 Transketolase, N-terminal
4 276 Gene3D G3DSA:3.40.50.970 -
3 273 SUPERFAMILY SSF52518 Thiamin diphosphate-binding fold (THDP-binding)
3 273 InterPro IPR029061 Thiamin diphosphate-binding fold
7 275 PANTHER PTHR47514 TRANSKETOLASE N-TERMINAL SECTION-RELATED
8 28 Coils Coil Coil
16 262 CDD cd02012 TPP_TK
16 262 InterPro IPR005474 Transketolase, N-terminal

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.812
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.097
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.008
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #7
0.426
Show in viewer
Surrounding area
Pocket 2 FPocket #11
0.38
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A1W1QTK6
AlphaFold DB full sequence Viewing
ColabFold VK055_1942
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

106 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 56 records from similar proteins
Structural ligands 27 0 loaded crystals
Measured bioactivity 29 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
1U0 PDB via homolog 483.4 Da · LogP 1.12 · TPSA 205.5 Open detail RCSB PDB
1Y7 PDB via homolog Detail RCSB PDB
5SP PDB via homolog Detail RCSB PDB
8EF PDB via homolog Detail RCSB PDB
8EL PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1U0 RCSB PDB P29401 483.4 Da LogP 1.12 TPSA 205.5 1 viol. ✓ Clean Cc1c(sc(c1Cc2cnc(nc2N)C)[C@@H](CO)O)CCOP(=O)(O)…
1Y7 RCSB PDB P29401 292.2 Da LogP -4.11 TPSA 188.1 1 viol. ✓ Clean C([C@@H]([C@H]([C@@H]([C@@H]([C@@H](COP(=O)(O)O…
5SP RCSB PDB P34736 230.1 Da LogP -2.62 TPSA 144.5 ✓ Ro5 ✓ Clean C([C@H]([C@@H](C(=O)CO)O)O)OP(=O)(O)O
8EF RCSB PDB P34736 426.3 Da LogP 1.37 TPSA 168.3 ✓ Ro5 ✓ Clean Cc1ncc(c(n1)N)CN2CS[C@H](C2=C)CCOP(=O)(O)OP(=O)…
8EL RCSB PDB P34736 426.3 Da LogP 1.72 TPSA 168.3 ✓ Ro5 ✓ Clean Cc1ncc(c(n1)N)CN2CSC(=C2C)CCOP(=O)(O)OP(=O)(O)O
8EO RCSB PDB P34736 427.3 Da LogP 1.03 TPSA 168.1 ✓ Ro5 ✓ Clean Cc1ncc(c(n1)N)C[N+]2=C([C@@H](SC2)CCOP(=O)(O)OP…
8FL RCSB PDB P34736 442.3 Da LogP 1.04 TPSA 188.6 ✓ Ro5 ✓ Clean Cc1ncc(c(n1)N)CN2[C@@H](SC(=C2C)CCOP(=O)(O)OP(=…
8GF RCSB PDB P34736 109.1 Da LogP 0.37 TPSA 51.8 ✓ Ro5 ✓ Clean Cc1nccc(n1)N
8ML RCSB PDB P34736 686.5 Da LogP -2.34 TPSA 336.2 3 viol. ✓ Clean Cc1ncc(c(n1)N)CN2C(SC(C2=C)CCOP(=O)(O)OP(=O)(O)…
8N9 RCSB PDB P34736 484.4 Da LogP 1.48 TPSA 208.8 2 viol. ✓ Clean Cc1ncc(c(n1)N)CN\2C(=C(S/C2=C(\CO)/O)CCOP(=O)(O…
BTB RCSB PDB A0A6L7H165 209.2 Da LogP -3.01 TPSA 104.4 ✓ Ro5 ✓ Clean C(CO)N(CCO)C(CO)(CO)CO
DX5 RCSB PDB P29401 232.1 Da LogP -2.83 TPSA 147.7 1 viol. ✓ Clean C([C@@H]([C@H]([C@@H](COP(=O)(O)O)O)O)O)O
E4P RCSB PDB P34736 200.1 Da LogP -1.98 TPSA 124.3 ✓ Ro5 ✓ Clean C([C@H]([C@H](C=O)O)O)OP(=O)(O)O
F6R RCSB PDB P34736 260.1 Da LogP -3.26 TPSA 164.8 1 viol. ✓ Clean C([C@H]([C@H]([C@@H](C(=O)CO)O)O)O)OP(=O)(O)O
HSX RCSB PDB P34736 230.1 Da LogP -2.47 TPSA 136.7 ✓ Ro5 ✓ Clean C([C@@H]1[C@H]([C@H]([C@H](O1)O)O)O)OP(=O)(O)O
I22 RCSB PDB P34736 290.2 Da LogP -3.90 TPSA 185.0 1 viol. ✓ Clean C([C@H]([C@H]([C@H]([C@@H](C(=O)CO)O)O)O)O)OP(=…
M6T RCSB PDB P23254 438.3 Da LogP 0.52 TPSA 171.8 ✓ Ro5 ✓ Clean Cc1c(c(nc(n1)C)N)C[n+]2csc(c2C)CCO[P@](=O)(O)O[…
N1T RCSB PDB P23254 423.3 Da LogP 0.81 TPSA 158.9 ✓ Ro5 ✓ Clean Cc1ccc(c(n1)N)C[n+]2csc(c2C)CCO[P@](=O)(O)O[P@@…
N3T RCSB PDB P23254 423.3 Da LogP 0.81 TPSA 158.9 ✓ Ro5 ✓ Clean Cc1cc(c(cn1)C[n+]2csc(c2C)CCO[P@](=O)(O)O[P@@](…
P23 RCSB PDB P34736 220.1 Da LogP 0.62 TPSA 113.3 ✓ Ro5 ✓ Clean CCCO[P@@](=O)(O)OP(=O)(O)O
PG5 RCSB PDB A0A6L7H165 178.2 Da LogP 0.31 TPSA 36.9 ✓ Ro5 ✓ Clean COCCOCCOCCOC
POP RCSB PDB P34736 176.0 Da LogP -2.08 TPSA 129.9 ✓ Ro5 ✓ Clean O[P@@](=O)([O-])O[P@@](=O)(O)[O-]
R5P RCSB PDB Q0P7Y3 230.1 Da LogP -2.62 TPSA 144.5 ✓ Ro5 ✓ Clean C(C(C(C(C=O)O)O)O)OP(=O)(O)O
RP5 RCSB PDB Q0P7Y3 230.1 Da LogP -2.47 TPSA 136.7 ✓ Ro5 ✓ Clean C([C@@H]1[C@H]([C@H]([C@@H](O1)O)O)O)OP(=O)(O)O
S6P RCSB PDB P29401 262.2 Da LogP -3.47 TPSA 167.9 1 viol. ✓ Clean C([C@@H]([C@H]([C@@H]([C@@H](COP(=O)(O)O)O)O)O)…
T5X RCSB PDB P34736 655.4 Da LogP -2.15 TPSA 316.6 3 viol. ✓ Clean Cc1c(sc([n+]1Cc2cnc(nc2N)C)[C@](CO)([C@H]([C@@H…
T6F RCSB PDB P29401 685.5 Da LogP -2.79 TPSA 336.9 3 viol. ✓ Clean Cc1c(sc([n+]1Cc2cnc(nc2N)C)[C@](CO)([C@H]([C@@H…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.