KpATCC43816 Protein target profile
lysine-arginine-ornithine-binding periplasmic family protein
Accession: VK055_2020
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 1.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 34.1 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 93.47 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKKSLLLWLALMASTSALAEGGKEIRFGVDPTFAPFEWKDPQGKLAGFDIDLGNAICQQLQAKCVWVESNFDGIIPALKARKFDAILSGMYMTEKRKAQIAFSDKLYNGPVFLVARKNTLQGNTPEQLKGKTIGVEQGSAQETYVNQHWRPQGINIVAYQGADSVVRDLESGRIDGAVLSGMMADYSFLQQPQGKEFAFVGGHLQDDTLFGAGAAIGLRKDDEALRQEINGAIAKILADGTYKKLAGKYFSFDVYSGT
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Periplasmic
Gene Ontology (GO)
2- GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
- GO:0071705 The directed movement of nitrogen-containing compounds into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 25 | 251 | Pfam | PF00497 | Bacterial extracellular solute-binding proteins, family 3 |
| 25 | 251 | InterPro | IPR001638 | Solute-binding protein family 3/N-terminal domain of MltF |
| 110 | 210 | Gene3D | G3DSA:3.40.190.10 | - |
| 1 | 19 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM |
| 1 | 21 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 20 | 258 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 47 | 60 | ProSitePatterns | PS01039 | Bacterial extracellular solute-binding proteins, family 3 signature. |
| 47 | 60 | InterPro | IPR018313 | Solute-binding protein family 3, conserved site |
| 5 | 250 | PANTHER | PTHR35936 | MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F |
| 12 | 19 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 1 | 19 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 23 | 250 | CDD | cd13703 | PBP2_HisJ_LAO |
| 1 | 19 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 26 | 249 | Gene3D | G3DSA:3.40.190.10 | - |
| 1 | 254 | SUPERFAMILY | SSF53850 | Periplasmic binding protein-like II |
| 24 | 253 | SMART | SM00062 | AABind_6 |
| 24 | 253 | InterPro | IPR001638 | Solute-binding protein family 3/N-terminal domain of MltF |
| 1 | 3 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 6 | 250 | NCBIfam | TIGR01096 | lysine/arginine/ornithine ABC transporter substrate-binding protein |
| 6 | 250 | InterPro | IPR005768 | Specific amino acids and opine-binding periplasmic protein, ABC transporter |
| 4 | 11 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GTC6
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_2020
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 2W2 RCSB PDB | P35120 | 304.3 Da LogP -1.39 TPSA 185.8 | 1 viol. | ✓ Clean |
[H]/N=C(/N)\NCCC[C@@H](C(=O)O)N[C@H](CCC(=O)O)C…
|
|
| 6DB RCSB PDB | P35120 | 246.3 Da LogP -1.23 TPSA 148.5 | 1 viol. | ✓ Clean |
[H]/N=C(/N)\NCCC[C@@H](C(=O)O)N[C@H](C)C(=O)O
|
|
| AOZ RCSB PDB | P35120 | 227.2 Da LogP -0.53 TPSA 115.3 | ✓ Ro5 | ✓ Clean |
CC(C(=O)O)NC(Cc1c[nH]cn1)C(=O)O
|
|
| AQK RCSB PDB | P35120 | 190.2 Da LogP -1.15 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
C(C[C@@H](C(=O)O)NCC(=O)O)CN
|
|
| AQQ RCSB PDB | P35120 | 204.2 Da LogP -0.76 TPSA 112.6 | ✓ Ro5 | ✓ Clean |
C[C@H](C(=O)O)N[C@@H](CCCN)C(=O)O
|
|
| OP1 RCSB PDB | P35120 | 286.3 Da LogP -1.22 TPSA 156.8 | ✓ Ro5 | ✓ Clean |
[H]/N=C(\N)/NCCC[C@@H](C(=O)O)N1[C@H](CCC1=O)C(…
|
|
| ORN RCSB PDB | P02911 | 132.2 Da LogP -0.86 TPSA 89.3 | ✓ Ro5 | ✓ Clean |
C(C[C@@H](C(=O)O)N)CN
|
|
| TOE RCSB PDB | P35120 | 164.2 Da LogP -0.34 TPSA 47.9 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCO
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1580161 ZINC | 1.000 | 208.3 Da LogP -0.33 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCO
|
| ZINC16052118 ZINC | 1.000 | 340.4 Da LogP -0.28 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCO
|
| ZINC16052257 ZINC | 1.000 | 384.5 Da LogP -0.26 TPSA 94.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC34317654 ZINC | 1.000 | 472.6 Da LogP -0.23 TPSA 112.5 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC44076059 ZINC | 1.000 | 428.5 Da LogP -0.24 TPSA 103.3 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5210101 ZINC | 1.000 | 252.3 Da LogP -0.31 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCO
|
| ZINC5997860 ZINC | 1.000 | 296.4 Da LogP -0.29 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCO
|
| ZINC575419714 ZINC | 0.727 | 312.4 Da LogP 0.42 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCSCCOCCOCCO
|
| ZINC115163232 ZINC | 0.700 | 222.3 Da LogP 0.07 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCCO
|
| ZINC258837490 ZINC | 0.700 | 354.4 Da LogP 0.11 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCCO
|
| ZINC12501520 ZINC | 0.688 | 458.5 Da LogP -0.88 TPSA 123.5 | 1 viol. | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC1692489 ZINC | 0.688 | 222.3 Da LogP 0.33 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOC
|
| ZINC3874716 ZINC | 0.688 | 414.5 Da LogP -0.90 TPSA 114.3 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC4283769 ZINC | 0.688 | 238.3 Da LogP -0.96 TPSA 77.4 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCO
|
| ZINC4521548 ZINC | 0.688 | 282.3 Da LogP -0.95 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCO
|
| ZINC4530388 ZINC | 0.688 | 266.3 Da LogP 0.35 TPSA 55.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOC
|
| ZINC5178829 ZINC | 0.688 | 326.4 Da LogP -0.93 TPSA 95.8 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5178830 ZINC | 0.688 | 370.4 Da LogP -0.91 TPSA 105.1 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5701172 ZINC | 0.688 | 310.4 Da LogP 0.36 TPSA 64.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOC
|
| ZINC5997861 ZINC | 0.688 | 398.5 Da LogP 0.40 TPSA 83.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOC
|
| ZINC575432150 ZINC | 0.667 | 344.4 Da LogP -0.89 TPSA 100.5 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCS(=O)(=O)CCOCCOCCO
|
| ZINC19815880 ZINC | 0.659 | 213.2 Da LogP -0.24 TPSA 104.3 | ✓ Ro5 | ✓ Clean |
COC(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O
|
| ZINC1857524240 ZINC | 0.652 | 207.3 Da LogP -0.75 TPSA 60.0 | ✓ Ro5 | ✓ Clean |
COCCNCCOCCOCCO
|
| ZINC22148708 ZINC | 0.651 | 239.3 Da LogP 0.57 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
CC(C)CC(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O
|
| ZINC22148712 ZINC | 0.651 | 239.3 Da LogP 0.57 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
CC(C)CC(=O)N[C@H](Cc1c[nH]cn1)C(=O)O
|
| ZINC1570743 ZINC | 0.628 | 239.3 Da LogP 0.57 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
CC(C)(C)C(=O)N[C@H](Cc1c[nH]cn1)C(=O)O
|
| ZINC4899806 ZINC | 0.622 | 254.3 Da LogP -0.50 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H](N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O
|
| ZINC31393708 ZINC | 0.619 | 235.1 Da LogP -0.91 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
O=C(O)[C@H](Cc1c[nH]cn1)NP(=O)(O)O
|
| ZINC1570742 ZINC | 0.614 | 223.2 Da LogP 0.10 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
C=C(C)C(=O)N[C@H](Cc1c[nH]cn1)C(=O)O
|
| ZINC5500513 ZINC | 0.614 | 223.2 Da LogP 0.10 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
C=C(C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O
|
| ZINC13600073 ZINC | 0.605 | 229.3 Da LogP -0.55 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
O=C(CS)N[C@@H](Cc1c[nH]cn1)C(=O)O
|
| ZINC5650743 ZINC | 0.600 | 222.3 Da LogP 0.07 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
CCOCCOCCOCCOCCO
|
| ZINC6403917 ZINC | 0.600 | 354.4 Da LogP 0.11 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
CCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC196899382 ZINC | 0.588 | 228.2 Da LogP -0.14 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCNC(=O)C(F)(F)F)C(=O)O
|
| ZINC257666436 ZINC | 0.587 | 261.3 Da LogP 0.92 TPSA 103.8 | ✓ Ro5 | ✓ Clean |
Cc1cc(C)nc(N[C@@H](Cc2c[nH]cn2)C(=O)O)n1
|
| ZINC116078641 ZINC | 0.583 | 222.2 Da LogP -0.80 TPSA 74.2 | ✓ Ro5 | ✓ Clean |
COC(=O)COCCOCCOCCO
|
| ZINC1857790631 ZINC | 0.583 | 280.3 Da LogP -0.39 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
COC(=O)CCOCCOCCOCCOCCO
|
| ZINC196151418 ZINC | 0.583 | 266.3 Da LogP -0.78 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
COC(=O)COCCOCCOCCOCCO
|
| ZINC202958272 ZINC | 0.583 | 236.3 Da LogP -0.41 TPSA 74.2 | ✓ Ro5 | ✓ Clean |
COC(=O)CCOCCOCCOCCO
|
| ZINC20567519 ZINC | 0.583 | 321.3 Da LogP -1.07 TPSA 135.7 | ✓ Ro5 | Alert |
CN1C(=O)C(=CN[C@@H](Cc2c[nH]cn2)C(=O)O)C(=O)N(C…
|
| ZINC20567520 ZINC | 0.583 | 321.3 Da LogP -1.07 TPSA 135.7 | ✓ Ro5 | Alert |
CN1C(=O)C(=CN[C@H](Cc2c[nH]cn2)C(=O)O)C(=O)N(C)…
|
| ZINC34111591 ZINC | 0.583 | 207.3 Da LogP -1.06 TPSA 62.2 | ✓ Ro5 | ✓ Clean |
COCCOCCN(CCO)CCO
|
| ZINC642881862 ZINC | 0.583 | 324.4 Da LogP -0.38 TPSA 92.7 | ✓ Ro5 | ✓ Clean |
COC(=O)CCOCCOCCOCCOCCOCCO
|
| ZINC1568163 ZINC | 0.578 | 259.3 Da LogP 0.84 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H](Cc1c[nH]cn1)C(=O)O)c1ccccc1
|
| ZINC15919758 ZINC | 0.578 | 245.3 Da LogP 1.20 TPSA 78.0 | ✓ Ro5 | ✓ Clean |
O=C(O)[C@H](Cc1c[nH]cn1)NCc1ccccc1
|
| ZINC8583964 ZINC | 0.578 | 226.2 Da LogP -1.13 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
NCCC(=O)N[C@H](Cc1c[nH]cn1)C(=O)O
|
| ZINC218761131 ZINC | 0.574 | 261.3 Da LogP 0.29 TPSA 103.8 | ✓ Ro5 | ✓ Clean |
Cc1ncc(CN[C@@H](Cc2c[nH]cn2)C(=O)O)cn1
|
| ZINC218761171 ZINC | 0.574 | 261.3 Da LogP 0.29 TPSA 103.8 | ✓ Ro5 | ✓ Clean |
Cc1ncc(CN[C@H](Cc2c[nH]cn2)C(=O)O)cn1
|
| ZINC2525827 ZINC | 0.563 | 268.3 Da LogP -0.95 TPSA 124.2 | ✓ Ro5 | ✓ Clean |
CC(=O)NCCC(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O
|
| ZINC218760743 ZINC | 0.560 | 304.4 Da LogP 0.81 TPSA 115.8 | ✓ Ro5 | ✓ Clean |
CC(C)Nc1ncc(CN[C@H](Cc2c[nH]cn2)C(=O)O)cn1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.