KpATCC43816 Protein target profile

acrA Membrane Fusion Protein

Accession: VK055_2105

Gene: AIK80710.1 acrA 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GP47
Export view
Length 397
Pocket druggability (P2Rank · AlphaFold DB model) 0.002
Functional annotation 0 EC 7 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Moderate predicted binding pocket FPocket selected-pocket score 0.45. This supports review but is not experimental validation. Structure available AlphaFold DB model + ColabFold model

Risks to review

Microbiome similarity 146 of 4744 screened genomes (3.1%) have a significant similarity hit. This target also has a predicted binding pocket (FPocket 0.45) — check the ligand evidence before deprioritizing on off-target risk alone. Weak second pocket-predictor signal P2Rank predicted binding-site probability 0.00.

Evidence gaps

No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
85.025 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
84.42 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.002
Structure A0A0H3GP47
Pocket Pocket 1
Druggability (FPocket) 0.448
Structure A0A0H3GP47
Pocket Pocket 15
ColabFold model
FPocket 0.532 · Pocket 10
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 146 / 4744 genomes with a hit
Prevalence 3.1%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MNKNRGLTPLAVVLMLSGSLALTGCDDKPAQQGAQHMPEVGIVTLKSAPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFVEGSDIQAGVSLYQIDPATYQASYDSAKGDLAKAQAAANMDQLTVKRYQKLLGTKYISQQDYDTAVATAQQSNAAVVAAKAAVETARINLAYTKVTSPISGRIGKSAVTEGALVQNGQTTALATVQQLDPIYVDVTQSSNDFLRLKQELADGRLKQENGKAKVELVTNDGLKYPQSGTLEFSGVTVDQTTGSITLRAIFPNPDHTLLPGMFVRARLEEGINPDALLVPQQGVTRTPRGDASVMVVGEGDKVEVRQVTASQAIGDKWLVTDGLKSGDRVIVTGLQKIKPGVQVKAQEVASDDKQQAAGNAPSEQTKS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

7 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

7
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0015721 The directed movement of bile acid and bile salts into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0046677 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
  • GO:0140330 A process that reduces or removes the toxicity of a xenobiotic by exporting it outside the cell through the outer membrane.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

25 records
Show feature table
Start End DB Term Name
52 300 SUPERFAMILY SSF111369 HlyD-like secretion proteins
1 5 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
6 16 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
284 376 Gene3D G3DSA:2.40.420.20 -
378 397 MobiDBLite mobidb-lite consensus disorder prediction
99 172 FunFam G3DSA:1.10.287.470:FF:000002 Efflux RND transporter periplasmic adaptor subunit
204 284 FunFam G3DSA:2.40.30.170:FF:000001 Multidrug resistance efflux transporter MdtE
375 397 MobiDBLite mobidb-lite consensus disorder prediction
1 21 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
22 397 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 21 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
99 172 Gene3D G3DSA:1.10.287.470 Helix hairpin bin
1 387 PANTHER PTHR30158 ACRA/E-RELATED COMPONENT OF DRUG EFFLUX TRANSPORTER
64 208 Gene3D G3DSA:2.40.50.100 -
40 375 NCBIfam TIGR01730 efflux RND transporter periplasmic adaptor subunit
40 375 InterPro IPR006143 RND efflux pump, membrane fusion protein
284 376 FunFam G3DSA:2.40.420.20:FF:000001 Efflux RND transporter periplasmic adaptor subunit
58 283 Gene3D G3DSA:2.40.30.170 -
63 293 Pfam PF16576 Barrel-sandwich domain of CusB or HlyD membrane-fusion
63 293 InterPro IPR032317 RND efflux pump, membrane fusion protein, barrel-sandwich domain
1 25 ProSiteProfiles PS51257 Prokaryotic membrane lipoprotein lipid attachment site profile.
45 360 Pfam PF00529 Cation efflux system protein CusB domain 1
45 360 InterPro IPR043602 Cation efflux system protein CusB, domain 1
17 21 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 21 Phobius SIGNAL_PEPTIDE Signal peptide region

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.002
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #15
0.448
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GP47
AlphaFold DB — — full sequence — Viewing
ColabFold VK055_2105
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GP47