KpATCC43816 Protein target profile
cytochrome o ubiquinol oxidase, subunit III
Accession: VK055_2162
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 27.891 Lower values reduce human off-target concern.
- Human E-value
- 1.77e-09
- Gut microbiome similarity
- 3.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 60.345 Higher values support similarity to known essential genes.
- DEG E-value
- 4.54e-72 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 81.29 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSDCIIFATLFATYAVLVNGTAGGPTGKDIFELPFVLVETALLLFSSITYGMAAIAMYKNNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIMEGFGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMFQVSRRGLTSTNRTRILCLSLFWHFLDVVWICVFSVVYLMGAM
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Gene Ontology (GO)
7- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0019646 A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to oxygen to generate a transmembrane electrochemical gradient.
- GO:0022904 A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
- GO:0009486 Catalysis of the reaction: 2 ubiquinol + O2 + 4 H+ = 2 ubiquinone + 2 H2O + 4 H+ [periplasmic space].
- GO:0004129 Catalysis of the reaction: 4 Fe(II)-[cytochrome c] + O2 + 8 H+(in) = 4 Fe(III)-[cytochrome c] + 2 H2O + 4 H+(out).
- GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 4 | 15 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 7 | 26 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 149 | 169 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 65 | 85 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 171 | Gene3D | G3DSA:1.20.120.80 | - |
| 1 | 171 | InterPro | IPR013833 | Cytochrome c oxidase, subunit III, 4-helical bundle |
| 21 | 35 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 169 | CDD | cd02863 | Ubiquinol_oxidase_III |
| 1 | 169 | InterPro | IPR033946 | Ubiquinol oxidase subunit III domain |
| 1 | 3 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 1 | 169 | PANTHER | PTHR11403 | CYTOCHROME C OXIDASE SUBUNIT III |
| 1 | 169 | InterPro | IPR024791 | Cytochrome c oxidase subunit III |
| 1 | 171 | FunFam | G3DSA:1.20.120.80:FF:000001 | Cytochrome (Ubi)quinol oxidase subunit III |
| 1 | 171 | NCBIfam | TIGR02842 | cytochrome o ubiquinol oxidase subunit III |
| 1 | 171 | InterPro | IPR014206 | Cytochrome o ubiquinol oxidase, subunit III |
| 1 | 20 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 148 | 170 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 16 | 20 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 36 | 58 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 65 | 85 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 105 | 127 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 59 | 64 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 170 | 171 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 4 | 169 | Pfam | PF00510 | Cytochrome c oxidase subunit III |
| 4 | 169 | InterPro | IPR000298 | Cytochrome c oxidase subunit III-like |
| 86 | 104 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 105 | 129 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 36 | 58 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 130 | 148 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 1 | 169 | SUPERFAMILY | SSF81452 | Cytochrome c oxidase subunit III-like |
| 1 | 169 | InterPro | IPR035973 | Cytochrome c oxidase subunit III-like superfamily |
| 1 | 170 | ProSiteProfiles | PS50253 | Heme-copper oxidase subunit III family profile. |
| 1 | 170 | InterPro | IPR000298 | Cytochrome c oxidase subunit III-like |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GJ52
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_2162
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 3PE RCSB PDB | P0ABJ3 | 748.1 Da LogP 12.06 TPSA 134.4 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCN)OC…
|
|
| 4AG RCSB PDB | P98005 | 568.9 Da LogP 10.40 TPSA 72.8 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@@H](CO)OC(=O)CCCCCCCCC…
|
|
| 5PL RCSB PDB | P98005 | 1233.7 Da LogP 15.13 TPSA 245.7 | 4 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCCCNC(=O)[C@@H](CO[C@@H]1[C@@H]…
|
|
| 7E8 RCSB PDB | P98005 | 300.4 Da LogP 3.36 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCC(=O)OC[C@@H](CO)O
|
|
| 7E9 RCSB PDB | P98005 | 300.4 Da LogP 3.36 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCC(=O)OC(CO)CO
|
|
| 9Y0 RCSB PDB | A0R049 | 718.0 Da LogP 11.05 TPSA 134.4 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)O[C@H](COC(=O)CCCCCCC/C=C\C…
|
|
| 9YF RCSB PDB | A0R049 | 853.1 Da LogP 8.75 TPSA 209.5 | 4 viol. | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)O[C@H](COC(=O)CCCCCCC[C@@H]…
|
|
| AZI RCSB PDB | P00415 | 42.0 Da LogP 0.87 TPSA 58.7 | ✓ Ro5 | Alert |
[N-]=[N+]=[N-]
|
|
| CDL RCSB PDB | A0R049 | 1464.1 Da LogP 23.31 TPSA 242.6 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)([O-])OCC(…
|
|
| CHD RCSB PDB | P00415 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@@H]2[C@@]1([C@H](C[C…
|
|
| CMO RCSB PDB | P00415 | 28.0 Da LogP -0.04 TPSA 19.9 | ✓ Ro5 | ✓ Clean |
[C-]#[O+]
|
|
| CQX RCSB PDB | P00415 | 364.5 Da LogP 0.96 TPSA 108.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCOCCO[C@@H]1[C@H]([C@H]([C@@H]([C@H](O…
|
|
| CUA RCSB PDB | P00415 | 127.1 Da LogP -0.01 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
[Cu][Cu]
|
|
| DCW RCSB PDB | P00415 | 224.3 Da LogP 2.95 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
C1CCC(CC1)NC(=O)NC2CCCCC2
|
|
| DMU RCSB PDB | P00415 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1)C…
|
|
| FES RCSB PDB | A0R049 | 175.8 Da LogP 1.29 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
S1[Fe]S[Fe]1
|
|
| FME RCSB PDB | P00415 | 177.2 Da LogP -0.06 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@@H](C(=O)O)NC=O
|
|
| HEO RCSB PDB | P0ABJ3 | 838.9 Da LogP 8.07 TPSA 110.7 | 2 viol. | ✓ Clean |
Cc1c2cc3[n+]4c(cc5c(c(c6n5[Fe]47n2c(c1CCC(=O)O)…
|
|
| LMU RCSB PDB | P84153 | 510.6 Da LogP -0.45 TPSA 178.5 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCO[C@@H]1[C@@H]([C@H]([C@@H]([C@H](O…
|
|
| MQ9 RCSB PDB | A0R049 | 785.3 Da LogP 17.55 TPSA 34.1 | 2 viol. | Alert |
CC1=C(C(=O)c2ccccc2C1=O)C\C=C(/C)\CC\C=C(/C)\CC…
|
|
| O RCSB PDB | P00415 | 18.0 Da LogP -0.82 TPSA 31.5 | ✓ Ro5 | ✓ Clean |
O
|
|
| OXY RCSB PDB | P00415 | 32.0 Da LogP 0.07 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
O=O
|
|
| PEE RCSB PDB | P00414 | 744.0 Da LogP 11.61 TPSA 134.4 | 2 viol. | ✓ Clean |
CCCCCCCC/C=C\CCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCN…
|
|
| PEK RCSB PDB | P00415 | 768.1 Da LogP 11.94 TPSA 134.4 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCCN…
|
|
| PER RCSB PDB | P00415 | 32.0 Da LogP -2.38 TPSA 46.1 | ✓ Ro5 | ✓ Clean |
[O-][O-]
|
|
| PGV RCSB PDB | P00415 | 749.0 Da LogP 10.45 TPSA 148.8 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](CO[P@](=O)(O)OC[C@H…
|
|
| PSC RCSB PDB | P00415 | 759.1 Da LogP 11.58 TPSA 108.4 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OCC[N…
|
|
| TGL RCSB PDB | P00415 | 891.5 Da LogP 18.77 TPSA 78.9 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OCC(COC(=O)CCCCCCCCCCCCCC…
|
|
| U9V RCSB PDB | P0ABJ3 | 524.9 Da LogP 10.65 TPSA 52.6 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OCCOC(=O)CCCCCCCCCCCCCC
|
|
| UQ8 RCSB PDB | P0ABJ3 | 727.1 Da LogP 14.40 TPSA 52.6 | 2 viol. | Alert |
CC1=C(C(=O)C(=C(C1=O)OC)OC)CC=C(C)CC\C=C(/C)\CC…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100028164 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H](C[C@…
|
| ZINC102190506 ZINC | 1.000 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OCCN)OC(=O)CC…
|
| ZINC102190512 ZINC | 1.000 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCCN)OC(=O)C…
|
| ZINC118912549 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H](C[C@@…
|
| ZINC118912550 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H](C[C@…
|
| ZINC118914076 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H](C[C@…
|
| ZINC157375 ZINC | 1.000 | 224.3 Da LogP 2.95 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCC1)NC1CCCCC1
|
| ZINC1636271 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[C@H](O)…
|
| ZINC17654071 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@H](O)C[…
|
| ZINC17654239 ZINC | 1.000 | 314.5 Da LogP 4.79 TPSA 52.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OCCOC(=O)CCCCCCC
|
| ZINC1857524335 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@H]2[C@H]3[C@H](C[C…
|
| ZINC1857524336 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@H]2[C@H]3[C@H](C[C@…
|
| ZINC2039285652 ZINC | 1.000 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H](C…
|
| ZINC2039285655 ZINC | 1.000 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H](C…
|
| ZINC2060993462 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3[C@H](O)…
|
| ZINC2060993463 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3[C@H](O)…
|
| ZINC2060993464 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3[C@H](O)…
|
| ZINC245204447 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C@H](O)C…
|
| ZINC245239737 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C@H](O)C…
|
| ZINC249681106 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C@@H](O…
|
| ZINC252479567 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C@H](O)…
|
| ZINC253497472 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C@H](O)…
|
| ZINC253497473 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C@H](O)C…
|
| ZINC253497474 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C@H](O)…
|
| ZINC253497475 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C@H](O)C…
|
| ZINC253536099 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[C@H](C…
|
| ZINC253536101 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[C@H](C…
|
| ZINC257345209 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@@H]2[C@H]3[C@H](O)C[…
|
| ZINC257354841 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C@H](C[C…
|
| ZINC257360748 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[C@H](C[…
|
| ZINC257360749 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[C@H](C[…
|
| ZINC29747682 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H](C[C@H…
|
| ZINC370205 ZINC | 1.000 | 252.4 Da LogP 3.73 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCCCC1)NC1CCCCC1
|
| ZINC376044 ZINC | 1.000 | 238.4 Da LogP 3.34 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCCC1)NC1CCCCC1
|
| ZINC40164245 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H](C[C@H…
|
| ZINC40164313 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@@H](O)C…
|
| ZINC43352176 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@H]2[C@H]3[C@H](C[C…
|
| ZINC44123745 ZINC | 1.000 | 252.4 Da LogP 3.73 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCCCCC1)NC1CCCCCC1
|
| ZINC599380959 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3[C@H](O)C…
|
| ZINC66157001 ZINC | 1.000 | 468.5 Da LogP -1.62 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H]…
|
| ZINC6858022 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H](C[C@H…
|
| ZINC6920392 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@H]2[C@H]3[C@H](C[C@…
|
| ZINC70669942 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O[C@H]2O[C@…
|
| ZINC70691804 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@@H]2[C@@H]3[C@H](O)C…
|
| ZINC70691805 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@@H]2[C@H]3[C@H](C[C@…
|
| ZINC77311968 ZINC | 1.000 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@@H]2O[C@H]…
|
| ZINC8214946 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@@H]2[C@H]3[C@H](O)C[…
|
| ZINC8214947 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@H](C[C@…
|
| ZINC85603116 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@@H]2[C@@H]3[C@H](C[C…
|
| ZINC95099755 ZINC | 1.000 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C@H](O)…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.