Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 36.269 Lower values reduce human off-target concern.
- Human E-value
- 4.03e-28
- Gut microbiome similarity
- 2.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 43.684 Higher values support similarity to known essential genes.
- DEG E-value
- 1.6400000000000002e-43 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 96.16 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSASALICLAPGSEETEAVTTIDLLVRGGVKVTTASVASVASDGSLTIVCSRGVKLLADAPLVEVADGDFDIIVLPGGIKGAECFRDSTLLVETVRQFHLSGRIVAAICAAPATVLVPHNLFPIGNMTGFPALKEHIPAEQWQDKRVVWDPRVNLLTSQGPGTSIDFALKMIDLLVGREKAYEVASQLVMAAGIYNYYEA
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Gene Ontology (GO)
1- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 5 | 186 | NCBIfam | TIGR01383 | DJ-1 family protein |
| 5 | 186 | InterPro | IPR006287 | Protein/nucleic acid deglycase DJ-1 |
| 5 | 175 | CDD | cd03135 | GATase1_DJ-1 |
| 1 | 18 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 11 | 18 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 5 | 191 | SUPERFAMILY | SSF52317 | Class I glutamine amidotransferase-like |
| 5 | 191 | InterPro | IPR029062 | Class I glutamine amidotransferase-like |
| 3 | 10 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 1 | 2 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 4 | 188 | PANTHER | PTHR48094 | PROTEIN/NUCLEIC ACID DEGLYCASE DJ-1-RELATED |
| 1 | 193 | FunFam | G3DSA:3.40.50.880:FF:000015 | Protein DJ-1 homolog C |
| 4 | 173 | Pfam | PF01965 | DJ-1/PfpI family |
| 4 | 173 | InterPro | IPR002818 | DJ-1/PfpI |
| 19 | 200 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 199 | Gene3D | G3DSA:3.40.50.880 | - |
| 1 | 199 | InterPro | IPR029062 | Class I glutamine amidotransferase-like |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GJ40
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_2177
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 2HA RCSB PDB | O59413 | 90.1 Da LogP -1.46 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C(C(=O)CO)O
|
|
| 72R RCSB PDB | Q99497 | 165.1 Da LogP 0.96 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
c1cc2c(cc1F)C(=O)C(=O)N2
|
|
| 72S RCSB PDB | Q99497 | 161.2 Da LogP 1.13 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
Cc1cccc2c1NC(=O)C2=O
|
|
| 72T RCSB PDB | Q99497 | 215.1 Da LogP 1.84 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
c1cc2c(c(c1)C(F)(F)F)NC(=O)C2=O
|
|
| 72U RCSB PDB | Q99497 | 205.2 Da LogP 0.61 TPSA 72.5 | ✓ Ro5 | ✓ Clean |
COC(=O)c1cccc2c1NC(=O)C2=O
|
|
| 72V RCSB PDB | Q99497 | 161.2 Da LogP 0.85 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
CN1c2ccccc2C(=O)C1=O
|
|
| 73D RCSB PDB | Q99497 | 175.2 Da LogP 1.24 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
CCN1c2ccccc2C(=O)C1=O
|
|
| 73G RCSB PDB | Q99497 | 261.3 Da LogP 1.56 TPSA 63.7 | ✓ Ro5 | ✓ Clean |
CCCCOC(=O)CN1c2ccccc2C(=O)C1=O
|
|
| 7MT RCSB PDB | O59413 | 556.4 Da LogP -2.25 TPSA 64.8 | 1 viol. | ✓ Clean |
c1cc2[n+]3c(c1)C(=O)O[Tb]34567[n+]8c(cccc8C(=O)…
|
|
| DTT RCSB PDB | Q99497 | 154.3 Da LogP -0.43 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
C([C@@H]([C@H](CS)O)O)S
|
|
| ISN RCSB PDB | Q99497 | 147.1 Da LogP 0.82 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
c1ccc2c(c1)C(=O)C(=O)N2
|
|
| MLA RCSB PDB | Q99497 | 104.1 Da LogP -0.45 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(C(=O)O)C(=O)O
|
|
| MLI RCSB PDB | O59413 | 102.0 Da LogP -3.12 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(=O)[O-]
|
|
| P15 RCSB PDB | Q99497 | 296.4 Da LogP -0.29 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCO
|
|
| P4C RCSB PDB | Q99497 | 324.4 Da LogP -0.72 TPSA 92.7 | ✓ Ro5 | ✓ Clean |
C(COCCOCCOCCOCCOCCOCC=O)O
|
|
| TLA RCSB PDB | Q99497 | 150.1 Da LogP -2.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
[C@@H]([C@H](C(=O)O)O)(C(=O)O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL5559797 ChEMBL | Q99497 | 7.72 ~19.1 nM | 466.5 Da LogP 1.80 TPSA 120.0 | ✓ Ro5 | ✓ Clean |
N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2cc(-n4c…
|
| CHEMBL5559582 ChEMBL | Q99497 | 7.68 ~20.9 nM | 530.6 Da LogP 1.10 TPSA 135.9 | 1 viol. | ✓ Clean |
N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2cccc(S(…
|
| CHEMBL5202724 ChEMBL | Q99497 | 7.26 ~55.0 nM | 299.3 Da LogP 2.61 TPSA 46.6 | ✓ Ro5 | ✓ Clean |
COc1cc(F)cc2c1N(CCc1ccccc1)C(=O)C2=O
|
| DWT ChEMBL | Q99497 | 7.26 ~55.0 nM | 503.5 Da LogP 5.75 TPSA 97.6 | 2 viol. | ✓ Clean |
Cc1ccc(cc1Nc2c3cn(nc3nc(n2)c4cccnc4)C)C(=O)Nc5c…
|
| CHEMBL406190 ChEMBL | Q99497 | 7.20 ~63.1 nM | 409.1 Da LogP 3.98 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
O=C1C(=O)N(CCc2ccccc2)c2c(Br)cc(Br)cc21
|
| CHEMBL5192433 ChEMBL | Q99497 | 7.07 ~85.1 nM | 289.7 Da LogP 3.69 TPSA 20.3 | ✓ Ro5 | ✓ Clean |
O=C1C(Cl)c2cc(F)ccc2N1CCc1ccccc1
|
| 73H ChEMBL | Q99497 | 6.93 ~117.5 nM | 269.3 Da LogP 2.60 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)CCN2c3ccc(cc3C(=O)C2=O)F
|
| CHEMBL5176828 ChEMBL | Q99497 | 6.93 ~117.5 nM | 193.2 Da LogP 1.37 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
CCN1C(=O)C(=O)c2cc(F)ccc21
|
| CHEMBL4802053 ChEMBL | Q99497 | 6.92 ~120.2 nM | 360.4 Da LogP 1.08 TPSA 138.1 | ✓ Ro5 | Alert |
N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)CN=[N+]=[…
|
| CHEMBL5205386 ChEMBL | Q99497 | 6.75 ~177.8 nM | 262.3 Da LogP 3.47 TPSA 34.1 | ✓ Ro5 | Alert |
O=C1C=C(CCc2ccccc2)c2ccccc2C1=O
|
| CHEMBL395485 ChEMBL | Q99497 | 6.57 ~269.2 nM | 425.1 Da LogP 3.95 TPSA 46.6 | ✓ Ro5 | ✓ Clean |
COc1ccc(CN2C(=O)C(=O)c3cc(Br)cc(Br)c32)cc1
|
| CHEMBL5183846 ChEMBL | Q99497 | 6.45 ~354.8 nM | 295.3 Da LogP 3.09 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
O=C1C(=O)N(CC2(c3ccccc3)CC2)c2ccc(F)cc21
|
| CHEMBL5209355 ChEMBL | Q99497 | 6.29 ~512.9 nM | 349.3 Da LogP 1.18 TPSA 88.2 | ✓ Ro5 | ✓ Clean |
C#CCOc1cc2ccccc2cc1C(=O)NC1=CC(=O)C2OC2C1O
|
| CHEMBL244322 ChEMBL | Q99497 | 6.17 ~676.1 nM | 409.1 Da LogP 4.25 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
Cc1ccc(CN2C(=O)C(=O)c3cc(Br)cc(Br)c32)cc1
|
| CHEMBL5200261 ChEMBL | Q99497 | 6.16 ~691.8 nM | 273.3 Da LogP 3.43 TPSA 20.3 | ✓ Ro5 | ✓ Clean |
O=C1C(F)c2cc(F)ccc2N1CCc1ccccc1
|
| 73F ChEMBL | Q99497 | 6.15 ~707.9 nM | 251.3 Da LogP 2.46 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)CCN2c3ccccc3C(=O)C2=O
|
| CHEMBL5198554 ChEMBL | Q99497 | 6.07 ~851.1 nM | 249.3 Da LogP 2.79 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CCN1C(=O)C(=O)c2cc(F)ccc21
|
| CHEMBL5177048 ChEMBL | Q99497 | — | 225.7 Da LogP 3.38 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CCC(C)c1ccc(NC(=O)CCl)cc1
|
| CHEMBL5185941 ChEMBL | Q99497 | — | 688.6 Da LogP 4.27 TPSA 128.0 | 1 viol. | ✓ Clean |
CC1=CC(C)=[N+]2C1=C(CCCCc1cn(CC(=O)N3CCc4nc(NC(…
|
| CHEMBL5188645 ChEMBL | Q99497 | — | 479.6 Da LogP 1.38 TPSA 122.5 | ✓ Ro5 | ✓ Clean |
CN1C(=O)CC(C(=O)N2CCc3nc(NC(=O)[C@H]4CCN(C#N)C4…
|
| CHEMBL5191068 ChEMBL | Q99497 | — | 1082.3 Da LogP 5.71 TPSA 267.0 | 3 viol. | ✓ Clean |
CC[N+]1=C(/C=C/C=C/C=C2/N(CCCCCC(=O)NCCCc3cn(CC…
|
| CHEMBL5193433 ChEMBL | Q99497 | — | 396.5 Da LogP 1.41 TPSA 102.2 | ✓ Ro5 | ✓ Clean |
N#CN1CC[C@H](C(=O)Nc2nc3c(s2)CN(C(=O)Cc2ccncc2)…
|
| CHEMBL5196840 ChEMBL | Q99497 | — | 204.6 Da LogP 1.87 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1csc(C(=O)CCl)c1
|
| CHEMBL5196847 ChEMBL | Q99497 | — | 440.4 Da LogP 2.33 TPSA 89.3 | ✓ Ro5 | ✓ Clean |
N#CN1CC[C@H](C(=O)Nc2nc3c(s2)CN(C(=O)CCCCBr)CC3…
|
| CHEMBL5202220 ChEMBL | Q99497 | — | 799.9 Da LogP 3.70 TPSA 249.4 | 2 viol. | ✓ Clean |
N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)Cn2cc(CCC…
|
| CHEMBL5204865 ChEMBL | Q99497 | — | 332.3 Da LogP 0.83 TPSA 113.2 | ✓ Ro5 | ✓ Clean |
O=c1ccc(NS(=O)(=O)c2cccc(S(=O)(=O)F)c2)c[nH]1
|
| CHEMBL5527958 ChEMBL | Q99497 | — | 500.6 Da LogP 1.52 TPSA 135.5 | 1 viol. | ✓ Clean |
N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2cccc(S(…
|
| CHEMBL5532418 ChEMBL | Q99497 | — | 572.7 Da LogP 2.66 TPSA 135.9 | 1 viol. | ✓ Clean |
COc1ccc(C(=O)N2CCc3nc(NC(=O)[C@@H]4CCN(C#N)C4)s…
|
| CHEMBL5532466 ChEMBL | Q99497 | — | 1334.6 Da LogP 5.86 TPSA 324.6 | 3 viol. | ✓ Clean |
CC[N+]1=C(/C=C/C=C/C=C2/N(CCCCCC(=O)NCCCc3cn(CC…
|
| CHEMBL5557416 ChEMBL | Q99497 | — | 478.6 Da LogP 3.52 TPSA 102.2 | ✓ Ro5 | ✓ Clean |
Cc1csc(-c2cccc(C(=O)N3CCc4nc(NC(=O)[C@@H]5CCN(C…
|
| CHEMBL5561942 ChEMBL | Q99497 | — | 535.1 Da LogP 2.28 TPSA 126.7 | 1 viol. | ✓ Clean |
N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2ccc(Cl)…
|
| CHEMBL5564608 ChEMBL | Q99497 | — | 449.5 Da LogP 2.13 TPSA 128.2 | ✓ Ro5 | ✓ Clean |
N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2cccc(-c…
|
| CHEMBL5565792 ChEMBL | Q99497 | — | 397.5 Da LogP 1.79 TPSA 109.6 | ✓ Ro5 | ✓ Clean |
N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2cccc(O)…
|
| CHEMBL5567367 ChEMBL | Q99497 | — | 1162.4 Da LogP 7.45 TPSA 267.0 | 3 viol. | ✓ Clean |
CC[N+]1=C(/C=C/C=C/C=C2/N(CCCCCC(=O)NCCCc3cn(-c…
|
| CHEMBL5567754 ChEMBL | Q99497 | — | 768.7 Da LogP 6.01 TPSA 128.0 | 2 viol. | ✓ Clean |
CC1=CC(C)=[N+]2C1=C(CCCCc1cn(-c3ccc(F)c(C(=O)N4…
|
| CHEMBL5567756 ChEMBL | Q99497 | — | 571.7 Da LogP 0.94 TPSA 147.0 | 1 viol. | ✓ Clean |
CC(=O)N1CCN(S(=O)(=O)c2cccc(C(=O)N3CCc4nc(NC(=O…
|
| CHEMBL5567767 ChEMBL | Q99497 | — | 470.6 Da LogP 3.27 TPSA 102.2 | ✓ Ro5 | ✓ Clean |
N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2cnc(-c4…
|
| CHEMBL5568566 ChEMBL | Q99497 | — | 474.4 Da LogP 3.15 TPSA 89.3 | ✓ Ro5 | ✓ Clean |
Cc1cc(C(=O)N2CCc3nc(NC(=O)[C@@H]4CCN(C#N)C4)sc3…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1580161 ZINC | 1.000 | 208.3 Da LogP -0.33 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCO
|
| ZINC16052118 ZINC | 1.000 | 340.4 Da LogP -0.28 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCO
|
| ZINC16052257 ZINC | 1.000 | 384.5 Da LogP -0.26 TPSA 94.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC2268444 ZINC | 1.000 | 251.3 Da LogP 2.46 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
O=C1C(=O)N(CCc2ccccc2)c2ccccc21
|
| ZINC2332288 ZINC | 1.000 | 205.2 Da LogP 0.61 TPSA 72.5 | ✓ Ro5 | ✓ Clean |
COC(=O)c1cccc2c1NC(=O)C2=O
|
| ZINC2487385 ZINC | 1.000 | 215.1 Da LogP 1.84 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2c(cccc2C(F)(F)F)C1=O
|
| ZINC34317654 ZINC | 1.000 | 472.6 Da LogP -0.23 TPSA 112.5 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC44076059 ZINC | 1.000 | 428.5 Da LogP -0.24 TPSA 103.3 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5210101 ZINC | 1.000 | 252.3 Da LogP -0.31 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCO
|
| ZINC5423920 ZINC | 1.000 | 269.3 Da LogP 2.60 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
O=C1C(=O)N(CCc2ccccc2)c2ccc(F)cc21
|
| ZINC5997860 ZINC | 1.000 | 296.4 Da LogP -0.29 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCO
|
| ZINC9583261 ZINC | 1.000 | 261.3 Da LogP 1.56 TPSA 63.7 | ✓ Ro5 | ✓ Clean |
CCCCOC(=O)CN1C(=O)C(=O)c2ccccc21
|
| ZINC2983461 ZINC | 0.818 | 265.3 Da LogP 2.85 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
O=C1C(=O)N(CCCc2ccccc2)c2ccccc21
|
| ZINC4744603 ZINC | 0.800 | 344.2 Da LogP 3.80 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
Cc1ccc(CN2C(=O)C(=O)c3cc(Br)cc(C)c32)cc1
|
| ZINC5234823 ZINC | 0.795 | 360.2 Da LogP 3.50 TPSA 46.6 | ✓ Ro5 | ✓ Clean |
COc1ccc(CN2C(=O)C(=O)c3cc(Br)cc(C)c32)cc1
|
| ZINC16946235 ZINC | 0.759 | 241.2 Da LogP 2.63 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccc(-c3ccc(F)cc3)cc2C1=O
|
| ZINC253787 ZINC | 0.758 | 205.3 Da LogP 3.55 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CCC(=O)Nc1ccc([C@H](C)CC)cc1
|
| ZINC253788 ZINC | 0.758 | 205.3 Da LogP 3.55 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CCC(=O)Nc1ccc([C@@H](C)CC)cc1
|
| ZINC1722373 ZINC | 0.756 | 233.2 Da LogP 0.78 TPSA 63.7 | ✓ Ro5 | ✓ Clean |
CCOC(=O)CN1C(=O)C(=O)c2ccccc21
|
| ZINC1607937 ZINC | 0.750 | 266.3 Da LogP 2.55 TPSA 40.6 | ✓ Ro5 | ✓ Clean |
CN1C(=O)c2ccccc2N(C)C(=O)c2ccccc21
|
| ZINC373252 ZINC | 0.735 | 233.4 Da LogP 4.18 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CC[C@@H](C)c1ccc(NC(=O)CC(C)C)cc1
|
| ZINC373254 ZINC | 0.735 | 233.4 Da LogP 4.18 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CC[C@H](C)c1ccc(NC(=O)CC(C)C)cc1
|
| ZINC3130265 ZINC | 0.733 | 320.3 Da LogP 1.45 TPSA 74.8 | ✓ Ro5 | ✓ Clean |
O=C1C(=O)N(CCN2C(=O)C(=O)c3ccccc32)c2ccccc21
|
| ZINC1613212 ZINC | 0.732 | 261.3 Da LogP 1.63 TPSA 63.7 | ✓ Ro5 | ✓ Clean |
CCCCOC(=O)CN1C(=O)c2ccccc2C1=O
|
| ZINC16974563 ZINC | 0.727 | 238.2 Da LogP 2.50 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2C(=O)Nc2ccccc21
|
| ZINC575419714 ZINC | 0.727 | 312.4 Da LogP 0.42 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCSCCOCCOCCO
|
| ZINC100643790 ZINC | 0.714 | 290.3 Da LogP 3.43 TPSA 58.2 | ✓ Ro5 | Alert |
Cc1cccc2c1N/C(=C1\Nc3c(C)cccc3C1=O)C2=O
|
| ZINC104252805 ZINC | 0.714 | 298.2 Da LogP 3.09 TPSA 58.2 | ✓ Ro5 | Alert |
O=C1/C(=C2\Nc3ccc(F)cc3C2=O)Nc2ccc(F)cc21
|
| ZINC104252809 ZINC | 0.714 | 298.2 Da LogP 3.09 TPSA 58.2 | ✓ Ro5 | Alert |
O=C1/C(=C2/Nc3ccc(F)cc3C2=O)Nc2ccc(F)cc21
|
| ZINC2173005 ZINC | 0.714 | 306.3 Da LogP 1.40 TPSA 74.8 | ✓ Ro5 | ✓ Clean |
O=C1C(=O)N(CN2C(=O)C(=O)c3ccccc32)c2ccccc21
|
| ZINC462619 ZINC | 0.714 | 233.3 Da LogP 3.12 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
CC[C@@H](C)c1ccc(NC(=O)CC(C)=O)cc1
|
| ZINC462621 ZINC | 0.714 | 233.3 Da LogP 3.12 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
CC[C@H](C)c1ccc(NC(=O)CC(C)=O)cc1
|
| ZINC5456564 ZINC | 0.714 | 219.3 Da LogP 3.94 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CCCC(=O)Nc1ccc([C@@H](C)CC)cc1
|
| ZINC5456569 ZINC | 0.714 | 219.3 Da LogP 3.94 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CCCC(=O)Nc1ccc([C@H](C)CC)cc1
|
| ZINC3845334 ZINC | 0.711 | 219.2 Da LogP 1.00 TPSA 72.5 | ✓ Ro5 | ✓ Clean |
CCOC(=O)c1cccc2c1NC(=O)C2=O
|
| ZINC2488440 ZINC | 0.707 | 285.7 Da LogP 3.11 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
O=C1C(=O)N(CCc2ccccc2)c2ccc(Cl)cc21
|
| ZINC2941174 ZINC | 0.707 | 330.2 Da LogP 3.22 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
O=C1C(=O)N(CCc2ccccc2)c2ccc(Br)cc21
|
| ZINC4318197 ZINC | 0.707 | 265.3 Da LogP 2.77 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
Cc1ccc2c(c1)C(=O)C(=O)N2CCc1ccccc1
|
| ZINC9583265 ZINC | 0.702 | 340.2 Da LogP 2.32 TPSA 63.7 | ✓ Ro5 | ✓ Clean |
CCCCOC(=O)CN1C(=O)C(=O)c2cc(Br)ccc21
|
| ZINC115163232 ZINC | 0.700 | 222.3 Da LogP 0.07 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCCO
|
| ZINC258837490 ZINC | 0.700 | 354.4 Da LogP 0.11 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCCO
|
| ZINC1657402 ZINC | 0.697 | 237.3 Da LogP 2.42 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
O=C1C(=O)N(Cc2ccccc2)c2ccccc21
|
| ZINC12359024 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC1532740 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC23257111 ZINC | 0.692 | 349.4 Da LogP 2.03 TPSA 43.9 | ✓ Ro5 | ✓ Clean |
O=C1C(=O)N(CN2CCN(CCc3ccccc3)CC2)c2ccccc21
|
| ZINC2383134600 ZINC | 0.692 | 290.3 Da LogP 2.55 TPSA 40.6 | ✓ Ro5 | Alert |
CN1C(=O)C(=C2C(=O)N(C)c3ccccc32)c2ccccc21
|
| ZINC3860635 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC45069770 ZINC | 0.692 | 285.3 Da LogP 4.61 TPSA 20.3 | ✓ Ro5 | ✓ Clean |
CN1C(=O)c2ccccc2-c2ccccc2-c2ccccc21
|
| ZINC5526456 ZINC | 0.692 | 220.2 Da LogP 0.60 TPSA 88.0 | ✓ Ro5 | ✓ Clean |
COC(=O)c1cccc2c1NC(=O)/C2=N\O
|
| ZINC6072527 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.