Protein target profile

VK055_2182

1-deoxy-D-xylulose-5-phosphate synthase

Genome: KpATCC43816 Gene: dxs AIK80787.1 3D evidence: Experimental + ColabFold model Metabolism 1 reaction UniProt A6T5F3
Length 620
Pocket druggability 0.978
Metabolic reactions 1
Chokepoint Yes
Direct ligand evidence 0 93 total records
Functional annotation 0 EC 3 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
23.993 Lower values reduce human off-target concern.
Human E-value
8.39e-17
Gut microbiome similarity
5.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
91.129 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
91.34 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

PDB experimental structure

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.978
Structure 8BZX
Pocket Pocket 1
P2Rank 0.941
Structure 8BZX
Pocket Pocket 1
ColabFold model
FPocket 0.981 · Pocket 1
P2Rank 0.985 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 266 / 4744 genomes with a hit
Prevalence 5.6%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a producing chokepoint reaction in Terpenoid backbone biosynthesis, no isoenzyme backup detected, more central than 98.0% of genes in this genome.

Relative network centrality 98.0% more central than 98.0% of genes in this genome
Chokepoint Chokepoint gene
Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGVAIAAAKEDKQRRAVCVIGDGAITAGMAFEAMNHAGDIKPDLLVVLNDNEMSISENVGALNNHLAQLLSGKLYSTLREGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLVSTLKNMRDLKGPQFLHIMTKKGRGYEPAEKDPITFHAVPKFDHTSGVLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSKKFPDRYFDVAIAEQHAVTFAAGLAIGDYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSFLRCIPDMVVMTPSDENECRQMLYTGYHYSDGPCAVRYPRGSGTGATLEPLASLPIGKGVVKRQGEKIAILNFGTLLPEAAAVADKLNATLVDMRFVKPLDTALILQLAGEHDALVTLEENAIMGGAGSGVNEVLMAHRRAVPVLNIGLPDYFIPQGTQEEIRADLGLDAAGIEAKIRDCLA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
  • GO:0016114 The chemical reactions and pathways resulting in the formation of terpenoids, any member of a class of compounds characterized by an isoprenoid chemical structure.
  • GO:0008661 Catalysis of the reaction: D-glyceraldehyde 3-phosphate + H+ + pyruvate = 1-deoxy-D-xylulose 5-phosphate + CO2.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

33 records
Show feature table
Start End DB Term Name
47 288 CDD cd02007 TPP_DXS
47 288 InterPro IPR005477 Deoxyxylulose-5-phosphate synthase
320 479 Pfam PF02779 Transketolase, pyrimidine binding domain
320 479 InterPro IPR005475 Transketolase-like, pyrimidine-binding domain
317 504 SUPERFAMILY SSF52518 Thiamin diphosphate-binding fold (THDP-binding)
317 504 InterPro IPR029061 Thiamin diphosphate-binding fold
13 282 Pfam PF13292 1-deoxy-D-xylulose-5-phosphate synthase
13 282 InterPro IPR005477 Deoxyxylulose-5-phosphate synthase
318 486 FunFam G3DSA:3.40.50.970:FF:000005 1-deoxy-D-xylulose-5-phosphate synthase
10 620 Hamap MF_00315 1-deoxy-D-xylulose-5-phosphate synthase [dxs].
10 620 InterPro IPR005477 Deoxyxylulose-5-phosphate synthase
319 484 SMART SM00861 Transket_pyr_3
319 484 InterPro IPR005475 Transketolase-like, pyrimidine-binding domain
11 619 NCBIfam TIGR00204 1-deoxy-D-xylulose-5-phosphate synthase
11 619 InterPro IPR005477 Deoxyxylulose-5-phosphate synthase
323 478 CDD cd07033 TPP_PYR_DXS_TK_like
425 441 ProSitePatterns PS00802 Transketolase signature 2.
425 441 InterPro IPR020826 Transketolase binding site
492 619 SUPERFAMILY SSF52922 TK C-terminal domain-like
492 619 InterPro IPR009014 Transketolase C-terminal/Pyruvate-ferredoxin oxidoreductase domain II
1 291 Gene3D G3DSA:3.40.50.970 -
495 611 Pfam PF02780 Transketolase, C-terminal domain
495 611 InterPro IPR033248 Transketolase, C-terminal domain
318 493 Gene3D G3DSA:3.40.50.970 -
36 55 ProSitePatterns PS00801 Transketolase signature 1.
36 55 InterPro IPR005474 Transketolase, N-terminal
5 619 PANTHER PTHR43322 1-D-DEOXYXYLULOSE 5-PHOSPHATE SYNTHASE-RELATED
5 619 InterPro IPR005477 Deoxyxylulose-5-phosphate synthase
10 381 SUPERFAMILY SSF52518 Thiamin diphosphate-binding fold (THDP-binding)
10 381 InterPro IPR029061 Thiamin diphosphate-binding fold
495 620 Gene3D G3DSA:3.40.50.920 -
495 620 InterPro IPR009014 Transketolase C-terminal/Pyruvate-ferredoxin oxidoreductase domain II
495 620 FunFam G3DSA:3.40.50.920:FF:000002 1-deoxy-D-xylulose-5-phosphate synthase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.978
Likely same site as P2Rank 1 2.2 Å 24 shared residues 89% of smaller site
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.941
Likely same site as FPocket 1 2.2 Å 24 shared residues 89% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.049
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.012
Show in viewer
Surrounding area
All structural evidence 3 experimental · 1 predicted

Structural evidence

3 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 8A8Y
X-ray A Loaded
PDB 8A9C
X-ray A Loaded
PDB 8BZX
X-ray A Viewing
ColabFold VK055_2182
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

93 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 43 records from similar proteins
Structural ligands 13 0 loaded crystals
Measured bioactivity 30 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
1U0 PDB via homolog 483.4 Da · LogP 1.12 · TPSA 205.5 Open detail RCSB PDB
1Y7 PDB via homolog Detail RCSB PDB
COI PDB via homolog Detail RCSB PDB
DPO PDB via homolog Detail RCSB PDB
DX5 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1U0 RCSB PDB P29401 483.4 Da LogP 1.12 TPSA 205.5 1 viol. ✓ Clean Cc1c(sc(c1Cc2cnc(nc2N)C)[C@@H](CO)O)CCOP(=O)(O)…
1Y7 RCSB PDB P29401 292.2 Da LogP -4.11 TPSA 188.1 1 viol. ✓ Clean C([C@@H]([C@H]([C@@H]([C@@H]([C@@H](COP(=O)(O)O…
COI RCSB PDB P09061 130.1 Da LogP 0.69 TPSA 54.4 ✓ Ro5 ✓ Clean CC(C)CC(=O)C(=O)O
DPO RCSB PDB P77488 173.9 Da LogP -3.34 TPSA 135.6 ✓ Ro5 ✓ Clean [O-]P(=O)([O-])OP(=O)([O-])[O-]
DX5 RCSB PDB P29401 232.1 Da LogP -2.83 TPSA 147.7 1 viol. ✓ Clean C([C@@H]([C@H]([C@@H](COP(=O)(O)O)O)O)O)O
HTL RCSB PDB Q9RUB5 467.4 Da LogP 1.04 TPSA 186.0 ✓ Ro5 ✓ Clean Cc1c(sc([n+]1Cc2cnc(nc2N)C)C(=O)C)CCO[P@@](=O)(…
PYR RCSB PDB P21874 88.1 Da LogP -0.34 TPSA 54.4 ✓ Ro5 ✓ Clean CC(=O)C(=O)O
S6P RCSB PDB P29401 262.2 Da LogP -3.47 TPSA 167.9 1 viol. ✓ Clean C([C@@H]([C@H]([C@@H]([C@@H](COP(=O)(O)O)O)O)O)…
T6F RCSB PDB P29401 685.5 Da LogP -2.79 TPSA 336.9 3 viol. ✓ Clean Cc1c(sc([n+]1Cc2cnc(nc2N)C)[C@](CO)([C@H]([C@@H…
TDK RCSB PDB Q9RUB5 563.4 Da LogP 0.84 TPSA 235.7 3 viol. ✓ Clean Cc1c(sc([n+]1Cc2cnc(nc2N)C)[C@@](C)(O)[P@@](=O)…
THV RCSB PDB P21953 496.4 Da LogP 1.75 TPSA 189.2 ✓ Ro5 ✓ Clean Cc1c(sc([n+]1Cc2cnc(nc2N)C)[C-](C(C)C)O)CCO[P@@…
THW RCSB PDB P21953 530.4 Da LogP 2.14 TPSA 189.2 1 viol. ✓ Clean Cc1c(sc([n+]1Cc2cnc(nc2N)C)[C-](c3ccccc3)O)CCO[…
THY RCSB PDB P21953 510.4 Da LogP 2.14 TPSA 189.2 1 viol. ✓ Clean CC[C@H](C)[C-](c1[n+](c(c(s1)CCO[P@](=O)(O)OP(=…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.