KpATCC43816 Protein target profile

thiamine-monophosphate kinase

Accession: VK055_2185

Gene: thiL AIK80790.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A0H3GP01
Length 323
Pocket druggability (P2Rank · AlphaFold DB model) 0.703
Metabolic reactions 1
Chokepoint Yes
Direct ligand evidence 0 53 total records
Functional annotation 1 EC 5 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
84.52 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
93.97 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.703
Structure A0A0H3GP01
Pocket Pocket 1
Druggability (FPocket) 0.37
Structure A0A0H3GP01
Pocket Pocket 8
ColabFold model
P2Rank 0.842 · Pocket 1
FPocket 0.535 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 144 / 4744 genomes with a hit
Prevalence 3.0%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a consuming chokepoint reaction in Thiamine metabolism, no isoenzyme backup detected, more central than 93.3% of genes in this genome, no human homolog detected.

Relative network centrality 93.3% more central than 93.3% of genes in this genome
Chokepoint Chokepoint gene
Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MACGEFSLIARYFDRVKSARLDVETGIGDDCALLHIPEKKTLAISTDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGAEPAWLTLALTLPEVDEVWLEAFSDSLFVQLDYYDMQLIGGDTTRGPLSMTLGIHGFVPPGRAMKRAGAKPGDWIYVTGTPGDSAAGLAVLQNRLTVDEPSDADYLLARHLRPMPRVLQGQALRDLATSAIDLSDGLISDLGHILKASGCGARIDLDAMPYSDAMLRQVDSEQALRWALAGGEDYELCFTVPELNRGALDVALGHLGARFTCIGQIAPESEGLQFIRDGKPVALDLKGYDHFA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Subcellular localization

Localization
Unknown

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0009030 Catalysis of the reaction: ATP + thiamine phosphate = ADP + H+ + thiamine diphosphate.
  • GO:0009228 The chemical reactions and pathways resulting in the formation of thiamine (vitamin B1), a water soluble vitamin present in fresh vegetables and meats, especially liver.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0000287 Binding to a magnesium (Mg) ion.
  • GO:0009229 The chemical reactions and pathways resulting in the formation of thiamine diphosphate, a derivative of thiamine (vitamin B1) which acts as a coenzyme in a range of processes including the Krebs cycle.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

24 records
Show feature table
Start End DB Term Name
29 138 Pfam PF00586 AIR synthase related protein, N-terminal domain
29 138 InterPro IPR016188 PurM-like, N-terminal domain
2 144 FunFam G3DSA:3.30.1330.10:FF:000008 Thiamine-monophosphate kinase
145 323 FunFam G3DSA:3.90.650.10:FF:000012 Thiamine-monophosphate kinase
150 297 Pfam PF02769 AIR synthase related protein, C-terminal domain
150 297 InterPro IPR010918 PurM-like, C-terminal domain
143 308 SUPERFAMILY SSF56042 PurM C-terminal domain-like
143 308 InterPro IPR036676 PurM-like, C-terminal domain superfamily
4 296 CDD cd02194 ThiL
4 296 InterPro IPR006283 Thiamine-monophosphate kinase-like
2 144 Gene3D G3DSA:3.30.1330.10 -
2 144 InterPro IPR036921 PurM-like, N-terminal domain superfamily
3 322 Hamap MF_02128 Thiamine-monophosphate kinase [thiL].
3 322 InterPro IPR006283 Thiamine-monophosphate kinase-like
1 322 PIRSF PIRSF005303 Thiam_monoph_kin
1 322 InterPro IPR006283 Thiamine-monophosphate kinase-like
2 322 PANTHER PTHR30270 THIAMINE-MONOPHOSPHATE KINASE
2 322 InterPro IPR006283 Thiamine-monophosphate kinase-like
4 138 SUPERFAMILY SSF55326 PurM N-terminal domain-like
4 138 InterPro IPR036921 PurM-like, N-terminal domain superfamily
146 323 Gene3D G3DSA:3.90.650.10 -
146 323 InterPro IPR036676 PurM-like, C-terminal domain superfamily
4 322 NCBIfam TIGR01379 thiamine-phosphate kinase
4 322 InterPro IPR006283 Thiamine-monophosphate kinase-like

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.703
Likely same site as FPocket 1 5.3 Å 13 shared residues 72% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.178
Likely same site as FPocket 1 6.1 Å 7 shared residues 58% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.022
Likely same site as FPocket 8 3.2 Å 11 shared residues 92% of smaller site
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.017
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.006
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #8
0.37 Unusual size
Likely same site as P2Rank 3 3.2 Å 11 shared residues 92% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #1
0.33 Unusual size
Likely same site as P2Rank 1 5.3 Å 13 shared residues 72% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:121-122
UniProt: Binding site:122-122
UniProt: Binding site:146-146
UniProt: Binding site:212-212
UniProt: Binding site:214-214
UniProt: Binding site:215-215
UniProt: Binding site:263-263
UniProt: Binding site:30-30
UniProt: Binding site:319-319
UniProt: Binding site:45-45
UniProt: Binding site:46-46
UniProt: Binding site:47-47
UniProt: Binding site:54-54
UniProt: Binding site:75-75
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GP01
AlphaFold DB full sequence Viewing
ColabFold VK055_2185
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

53 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 3 records from similar proteins
Structural ligands 3 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
ACP PDB via homolog 505.2 Da · LogP -1.52 · TPSA 269.9 Open detail RCSB PDB
ANP PDB via homolog Detail RCSB PDB
TPS PDB via homolog Detail RCSB PDB
ZINC1532839 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC105469665 ZINC proposed compound · Tanimoto 0.873 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ACP RCSB PDB O67883 505.2 Da LogP -1.52 TPSA 269.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ANP RCSB PDB A0A0D5YC82 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
TPS RCSB PDB A0A0D5YC82 345.3 Da LogP 0.72 TPSA 122.4 ✓ Ro5 ✓ Clean Cc1c(sc[n+]1Cc2cnc(nc2N)C)CCOP(=O)(O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.