KpATCC43816 Protein target profile
taurine ABC transporter, periplasmic binding protein
Accession: VK055_2245
Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 1.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 26.236 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 94.36 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MAFTSRITLLAALAVAAFQAQAVNVTVAYQTSAEPAKVAQADNTFAKTSGATVDWRKFDSGASVVRALASGDVQIGNIGSSPLAVAASQQVPIEVFLLASKLGNSEALVVKKSITKPEDLIGKRIAVPFISTTHYSLLSALKHWGIKPGQVQIINLQPPAIIAAWQRGDIDGAYVWAPAVNELEKEGKVLTDSSQVGEWGAPTLDVWVVRKDFAEQHPEIVKAFAKSAIDAQQPYIANPEAWLKQPDNISKLARLSGVPEADVPGLVKGNTYLTAAEQAQALNGPVNQAIVDTARFLKEQGKVPAAGTDYRQYVTDRFVK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Gene Ontology (GO)
5- GO:0043190 A complex for the transport of metabolites into and out of the cell, typically comprised of four domains; two membrane-associated domains and two ATP-binding domains at the intracellular face of the membrane, that form a central pore through the plasma membrane. Each of the four core domains may be encoded as a separate polypeptide or the domains can be fused in any one of a number of ways into multidomain polypeptides. In Bacteria and Archaebacteria, ABC transporters also include substrate binding proteins to bind substrate external to the cytoplasm and deliver it to the transporter.
- GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
- GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
- GO:0042918 The directed movement of an alkanesulfonate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Alkanesulfonates are organic esters or salts of sulfonic acid containing an aliphatic hydrocarbon radical.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 24 | 232 | Pfam | PF04069 | Substrate binding domain of ABC-type glycine betaine transport system |
| 24 | 232 | InterPro | IPR007210 | ABC-type glycine betaine transport system, substrate-binding domain |
| 23 | 320 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 22 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 1 | 22 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 1 | 22 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 34 | 305 | SUPERFAMILY | SSF53850 | Periplasmic binding protein-like II |
| 24 | 239 | SMART | SM00062 | AABind_6 |
| 24 | 239 | InterPro | IPR001638 | Solute-binding protein family 3/N-terminal domain of MltF |
| 4 | 270 | PANTHER | PTHR30024 | ALIPHATIC SULFONATES-BINDING PROTEIN-RELATED |
| 131 | 320 | Gene3D | G3DSA:3.40.190.10 | - |
| 24 | 239 | CDD | cd13560 | PBP2_taurine |
| 24 | 239 | InterPro | IPR010068 | Taurine ABC transporter, substrate-binding protein TauA |
| 25 | 320 | NCBIfam | TIGR01729 | taurine ABC transporter substrate-binding protein |
| 25 | 320 | InterPro | IPR010068 | Taurine ABC transporter, substrate-binding protein TauA |
| 1 | 6 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 19 | 22 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 7 | 18 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 23 | 130 | Gene3D | G3DSA:3.40.190.10 | - |
| 19 | 123 | FunFam | G3DSA:3.40.190.10:FF:000128 | Taurine ABC transporter substrate-binding protein |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GNW2
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_2245
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| LUQ RCSB PDB | Q47537 | 182.2 Da LogP -2.05 TPSA 109.5 | ✓ Ro5 | ✓ Clean |
C(CS(=O)(=O)O)NCC(=O)N
|
|
| P7I RCSB PDB | Q47537 | 125.1 Da LogP -0.88 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C(CP(=O)(O)O)N
|
|
| TAU RCSB PDB | Q47537 | 125.1 Da LogP -1.17 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
C(CS(=O)(=O)O)N
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC59471161 ZINC | 0.600 | 265.4 Da LogP 2.73 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCS(=O)(=O)O
|
| ZINC96639846 ZINC | 0.600 | 265.3 Da LogP 3.02 TPSA 83.6 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCP(=O)(O)O
|
| ZINC1763010 ZINC | 0.529 | 218.3 Da LogP -0.46 TPSA 108.7 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCCS(=O)(=O)O
|
| ZINC2381636 ZINC | 0.529 | 218.1 Da LogP 0.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)CCCCP(=O)(O)O
|
| ZINC31962397 ZINC | 0.529 | 204.1 Da LogP -0.27 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)CCCP(=O)(O)O
|
| ZINC5225211 ZINC | 0.529 | 204.2 Da LogP -0.85 TPSA 108.7 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCS(=O)(=O)O
|
| ZINC396177158 ZINC | 0.522 | 257.3 Da LogP -1.12 TPSA 108.1 | ✓ Ro5 | ✓ Clean |
NCCOCCOCCOCCS(=O)(=O)O
|
| ZINC2381412 ZINC | 0.500 | 246.1 Da LogP 0.90 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)CCCCCCP(=O)(O)O
|
| ZINC2569998 ZINC | 0.500 | 232.1 Da LogP 0.51 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)CCCCCP(=O)(O)O
|
| ZINC34227522 ZINC | 0.500 | 302.2 Da LogP 2.46 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)CCCCCCCCCCP(=O)(O)O
|
| ZINC34744001 ZINC | 0.500 | 274.2 Da LogP 1.68 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)CCCCCCCCP(=O)(O)O
|
| ZINC38594934 ZINC | 0.500 | 330.3 Da LogP 3.24 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)CCCCCCCCCCCCP(=O)(O)O
|
| ZINC5113156 ZINC | 0.500 | 246.3 Da LogP 0.32 TPSA 108.7 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCCCCS(=O)(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.