KpATCC43816 Protein target profile
bacterial extracellular solute-binding, 3 familyprotein
Accession: VK055_2258
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 42.466 Lower values reduce human off-target concern.
- Human E-value
- 2.33e-06
- Gut microbiome similarity
- 1.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 32.171 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 93.44 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MRNKTTKIALALGMLLLASQAQADQLADIKAAGVVKVATFDANPPFGSVDAKTHHIVGYDVDFAQALAKALGVKLELVATNPANRIPLLQSGKADLIVADITITPERAQVIDFSTPYFVTGQQFLVPAGSPDKLDEYSKARIGAVKGTTGEQALHQRFPQARVLSYDDIPLALTALRNGNVQAITQDSTILAGLLAEAPDKAKFKILPDLLSKEEIGVGVKKGEPALLKAVNDELVKLEKTGEAAKIYDVWFGPATKTPQPRAFTIEAK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Periplasmic
Gene Ontology (GO)
5- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0015276 Enables the transmembrane transfer of an ion by a channel that opens when a specific ligand has been bound by the channel complex or one of its constituent parts.
- GO:0005576 The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
- GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
- GO:0006865 The directed movement of amino acids, organic acids containing one or more amino substituents, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 23 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 122 | 213 | Gene3D | G3DSA:3.40.190.10 | - |
| 1 | 7 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 58 | 71 | ProSitePatterns | PS01039 | Bacterial extracellular solute-binding proteins, family 3 signature. |
| 58 | 71 | InterPro | IPR018313 | Solute-binding protein family 3, conserved site |
| 26 | 253 | CDD | cd13689 | PBP2_BsGlnH |
| 19 | 23 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 34 | 254 | SMART | SM00079 | GluR_14 |
| 34 | 254 | InterPro | IPR001320 | Ionotropic glutamate receptor, C-terminal |
| 28 | 248 | Gene3D | G3DSA:3.40.190.10 | - |
| 1 | 23 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 24 | 269 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 35 | 253 | Pfam | PF00497 | Bacterial extracellular solute-binding proteins, family 3 |
| 35 | 253 | InterPro | IPR001638 | Solute-binding protein family 3/N-terminal domain of MltF |
| 8 | 18 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 34 | 255 | SMART | SM00062 | AABind_6 |
| 34 | 255 | InterPro | IPR001638 | Solute-binding protein family 3/N-terminal domain of MltF |
| 5 | 254 | SUPERFAMILY | SSF53850 | Periplasmic binding protein-like II |
| 6 | 262 | PANTHER | PTHR30085 | AMINO ACID ABC TRANSPORTER PERMEASE |
| 1 | 23 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GK59
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_2258
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Only proposed virtual-screening candidates are available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
No PDB ligands found through similar proteins.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1709624 ZINC | 0.600 | 248.2 Da LogP -2.17 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@H](CC(=O)N[C@H](CC(=O)O)C(=O)O)C(=O)O
|
| ZINC4155291 ZINC | 0.583 | 216.2 Da LogP -1.37 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
CC(=O)/N=C(\N)NCCC[C@H](N)C(=O)O
|
| ZINC4155299 ZINC | 0.583 | 216.2 Da LogP -1.37 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
CC(=O)/N=C(\N)NCCC[C@@H](N)C(=O)O
|
| ZINC1575288 ZINC | 0.560 | 248.2 Da LogP -2.17 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O
|
| ZINC1575289 ZINC | 0.560 | 248.2 Da LogP -2.17 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O
|
| ZINC1575290 ZINC | 0.560 | 248.2 Da LogP -2.17 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@@H](CC(=O)O)C(=O)N[C@H](CC(=O)O)C(=O)O
|
| ZINC1575291 ZINC | 0.560 | 248.2 Da LogP -2.17 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@H](CC(=O)O)C(=O)N[C@H](CC(=O)O)C(=O)O
|
| ZINC144076260 ZINC | 0.559 | 232.2 Da LogP -0.84 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC(=O)CC(=O)O)C(=O)O
|
| ZINC218922593 ZINC | 0.559 | 204.2 Da LogP -1.32 TPSA 112.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC(=O)CO)C(=O)O
|
| ZINC2516116 ZINC | 0.559 | 275.3 Da LogP -1.12 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC4545887 ZINC | 0.559 | 275.3 Da LogP -1.12 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC(=O)CC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC4545888 ZINC | 0.559 | 275.3 Da LogP -1.12 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)NCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC4545889 ZINC | 0.559 | 275.3 Da LogP -1.12 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCNC(=O)CC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC50027904 ZINC | 0.559 | 261.3 Da LogP -1.51 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC(=O)C[C@H](N)C(=O)O)C(=O)O
|
| ZINC12503853 ZINC | 0.556 | 201.3 Da LogP 0.55 TPSA 99.2 | ✓ Ro5 | ✓ Clean |
CCCC(=N)NCCC[C@H](N)C(=O)O
|
| ZINC1640080 ZINC | 0.556 | 232.3 Da LogP 0.70 TPSA 101.6 | ✓ Ro5 | ✓ Clean |
CC(C)(C)OC(=O)NCCC[C@H](N)C(=O)O
|
| ZINC217503161 ZINC | 0.556 | 230.3 Da LogP 0.88 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCCC(=O)NCCCC[C@H](N)C(=O)O
|
| ZINC2560765 ZINC | 0.556 | 232.3 Da LogP 0.70 TPSA 101.6 | ✓ Ro5 | ✓ Clean |
CC(C)(C)OC(=O)NCCC[C@@H](N)C(=O)O
|
| ZINC3055005 ZINC | 0.556 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC3055007 ZINC | 0.556 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC3055010 ZINC | 0.556 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC675038108 ZINC | 0.556 | 231.3 Da LogP -1.49 TPSA 123.3 | 1 viol. | ✓ Clean |
CNC(NC)C(=N)NCCC[C@H](N)C(=O)O
|
| ZINC100017163 ZINC | 0.553 | 213.3 Da LogP 0.71 TPSA 99.2 | ✓ Ro5 | ✓ Clean |
C/C=C/CC(=N)NCCC[C@H](N)C(=O)O
|
| ZINC19796052 ZINC | 0.553 | 219.2 Da LogP -1.73 TPSA 156.9 | ✓ Ro5 | ✓ Clean |
N/C(=N\[N+](=O)[O-])NCCC[C@H](N)C(=O)O
|
| ZINC21982226 ZINC | 0.553 | 219.2 Da LogP -1.73 TPSA 156.9 | ✓ Ro5 | ✓ Clean |
N/C(=N\[N+](=O)[O-])NCCC[C@@H](N)C(=O)O
|
| ZINC5113209 ZINC | 0.548 | 275.3 Da LogP -0.26 TPSA 138.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC6360447 ZINC | 0.543 | 222.3 Da LogP 0.37 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCNC(=S)S)C(=O)O
|
| ZINC1530092 ZINC | 0.541 | 254.2 Da LogP -1.61 TPSA 168.8 | 1 viol. | ✓ Clean |
N=C(NCCC[C@H](N)C(=O)O)NP(=O)(O)O
|
| ZINC230402790 ZINC | 0.541 | 214.3 Da LogP 0.26 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
C/C=C/C(=O)NCCCC[C@H](N)C(=O)O
|
| ZINC237993466 ZINC | 0.541 | 214.3 Da LogP 0.26 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
C/C=C/C(=O)NCCCC[C@@H](N)C(=O)O
|
| ZINC5965908 ZINC | 0.541 | 202.3 Da LogP -1.03 TPSA 99.7 | ✓ Ro5 | ✓ Clean |
C/N=C(\NC)NCCC[C@H](N)C(=O)O
|
| ZINC1555366 ZINC | 0.536 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1555367 ZINC | 0.536 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1555369 ZINC | 0.536 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1720127 ZINC | 0.536 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1720128 ZINC | 0.536 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1720130 ZINC | 0.536 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1565131 ZINC | 0.528 | 200.2 Da LogP -0.13 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
C=CC(=O)NCCCC[C@@H](N)C(=O)O
|
| ZINC1567145 ZINC | 0.528 | 218.3 Da LogP 0.31 TPSA 101.6 | ✓ Ro5 | ✓ Clean |
CCOC(=O)NCCCC[C@@H](N)C(=O)O
|
| ZINC1608689 ZINC | 0.528 | 202.3 Da LogP 0.09 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCCNC(=O)CC[C@H](N)C(=O)O
|
| ZINC1737889 ZINC | 0.528 | 245.3 Da LogP -0.33 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H](N)C(=O)NCCCC[C@H](N)C(=O)O
|
| ZINC1737892 ZINC | 0.528 | 245.3 Da LogP -0.33 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H](N)C(=O)NCCCC[C@H](N)C(=O)O
|
| ZINC1737894 ZINC | 0.528 | 245.3 Da LogP -0.33 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H](N)C(=O)NCCCC[C@@H](N)C(=O)O
|
| ZINC1737898 ZINC | 0.528 | 245.3 Da LogP -0.33 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H](N)C(=O)NCCCC[C@@H](N)C(=O)O
|
| ZINC2027403 ZINC | 0.528 | 200.2 Da LogP -0.13 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
C=CC(=O)NCCCC[C@H](N)C(=O)O
|
| ZINC2041390 ZINC | 0.528 | 218.3 Da LogP 0.31 TPSA 101.6 | ✓ Ro5 | ✓ Clean |
CCOC(=O)NCCCC[C@H](N)C(=O)O
|
| ZINC2045835 ZINC | 0.528 | 202.3 Da LogP 0.09 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCCNC(=O)CC[C@@H](N)C(=O)O
|
| ZINC2384794 ZINC | 0.528 | 242.2 Da LogP 0.25 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC(=O)C(F)(F)F)C(=O)O
|
| ZINC6292525 ZINC | 0.528 | 242.2 Da LogP 0.25 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCNC(=O)C(F)(F)F)C(=O)O
|
| ZINC71754172 ZINC | 0.528 | 246.3 Da LogP -0.45 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC(=O)CCC(=O)O)C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.