KpATCC43816 Protein target profile

phosphonate ABC transporter, periplasmic phosphonate binding protein

Accession: VK055_2269

Gene: AIK80874.1 phnD 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GNU5
Length 308
Pocket druggability (P2Rank · AlphaFold DB model) 0.887
Direct ligand evidence 0 17 total records
Functional annotation 0 EC 3 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
93.4 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.887
Structure A0A0H3GNU5
Pocket Pocket 1
Druggability (FPocket) 0.848
Structure A0A0H3GNU5
Pocket Pocket 1
ColabFold model
P2Rank 0.898 · Pocket 1
FPocket 0.807 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 37 / 4744 genomes with a hit
Prevalence 0.8%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MTGAVRLSAMVAGMMMAWQAAAAQPKELNLGILGGQNATQQIGDNQCVKAFLDKELNVDTKLRNSSDYSGVIQGLLGGKVDVVLSMSPSSYASVYLNNPKAVDIVGIAVDDKDQSRGYHSVVIVKADSPYKTLDDLKGKAFGFADPDSTSGYLIPNHAFKEKFGGNADNKYNNTFSSVTFSGGHEQDILGVLNGQFAGAVTWASMVGDYNTGYTTGAFNRLIRMDHPDLMKQIRIIWQSPLIPNGPILVSNALPADFKAKVVAAVKKLDTEDHACFIKAMGGTQHIGPGSVADFQQIIDMKRELVSAR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
Periplasmic

Gene Ontology (GO)

3
  • GO:0043190 A complex for the transport of metabolites into and out of the cell, typically comprised of four domains; two membrane-associated domains and two ATP-binding domains at the intracellular face of the membrane, that form a central pore through the plasma membrane. Each of the four core domains may be encoded as a separate polypeptide or the domains can be fused in any one of a number of ways into multidomain polypeptides. In Bacteria and Archaebacteria, ABC transporters also include substrate binding proteins to bind substrate external to the cytoplasm and deliver it to the transporter.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0015716 The directed movement of phosphonates into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. A phosphonate is any salt, anion, or ester of phosphonic acid (HPO(OH)2).

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
117 243 Gene3D G3DSA:3.40.190.10 -
1 23 SignalP_EUK SignalP-noTM SignalP-noTM
31 270 Gene3D G3DSA:3.40.190.10 -
23 308 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 22 Phobius SIGNAL_PEPTIDE Signal peptide region
15 304 PANTHER PTHR35841 PHOSPHONATES-BINDING PERIPLASMIC PROTEIN
7 303 NCBIfam TIGR03431 phosphonate ABC transporter substrate-binding protein
7 303 InterPro IPR017797 Phosphonate ABC transporter, substrate-binding protein
1 22 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
1 2 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
1 22 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
33 284 Pfam PF12974 ABC transporter, phosphonate, periplasmic substrate-binding protein
15 22 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
7 268 NCBIfam TIGR01098 phosphate/phosphite/phosphonate ABC transporter substrate-binding protein
7 268 InterPro IPR005770 Phosphate/phosphite/phosphonate ABC transporter, periplasmic binding protein
45 299 SUPERFAMILY SSF53850 Periplasmic binding protein-like II
3 14 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
25 298 CDD cd01071 PBP2_PhnD_like

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.887
Likely same site as FPocket 1 1.1 Å 27 shared residues 93% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.028
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.005
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.848
Likely same site as P2Rank 1 1.1 Å 27 shared residues 93% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #17
0.359
Show in viewer
Surrounding area
Pocket 3 FPocket #6
0.297
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GNU5
AlphaFold DB full sequence Viewing
ColabFold VK055_2269
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

17 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 6 records from similar proteins
Structural ligands 6 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 11 similarity-based ZINC candidates
Best available ligand signal
2PO PDB via homolog 80.0 Da · LogP -1.90 · TPSA 63.2 Open detail RCSB PDB
78T PDB via homolog Detail RCSB PDB
BTB PDB via homolog Detail RCSB PDB
GB PDB via homolog Detail RCSB PDB
HP4 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
2PO RCSB PDB O69052 80.0 Da LogP -1.90 TPSA 63.2 ✓ Ro5 ✓ Clean [O-]P(=O)[O-]
78T RCSB PDB A3PDP9 81.0 Da LogP -1.27 TPSA 60.4 ✓ Ro5 ✓ Clean OP(=O)[O-]
BTB RCSB PDB O69061 209.2 Da LogP -3.01 TPSA 104.4 ✓ Ro5 ✓ Clean C(CO)N(CCO)C(CO)(CO)CO
GB RCSB PDB O69052 96.0 Da LogP -0.21 TPSA 57.5 ✓ Ro5 ✓ Clean CP(=O)(O)O
HP4 RCSB PDB O69061 65.0 Da LogP -0.98 TPSA 40.1 ✓ Ro5 ✓ Clean [O-][PH2]=O
P7I RCSB PDB Q1R3F7 125.1 Da LogP -0.88 TPSA 83.5 ✓ Ro5 ✓ Clean C(CP(=O)(O)O)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.