KpATCC43816 Protein target profile

PTS system sugar-specific permease component family protein

Accession: VK055_2303

Gene: AIK80907.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GN52
Export view
Length 420
Pocket druggability (P2Rank · AlphaFold DB model) 0.934
Functional annotation 0 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Independent pocket support: P2Rank + FPocket Both predictors report a high-scoring binding site (P2Rank 0.93, FPocket 0.90). Use the 3D pocket comparison to verify whether they identify the same site. No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Strong predicted binding pocket FPocket selected-pocket score 0.90. This is a computational pocket signal, not binding validation. Second pocket predictor agrees P2Rank predicted binding-site probability 0.93. Review the complete evidence below

Risks to review

Microbiome similarity 18 of 4744 screened genomes (0.4%) have a significant similarity hit. This target also has a predicted binding pocket (P2Rank 0.93) — check the ligand evidence before deprioritizing on off-target risk alone. Mixed conservation Core/accessory calls are not fully concordant.

Evidence gaps

No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
40.587 Higher values support similarity to known essential genes.
DEG E-value
1.27e-106 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
91.58 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.934
Structure A0A0H3GN52
Pocket Pocket 1
Druggability (FPocket) 0.896
Structure A0A0H3GN52
Pocket Pocket 1
ColabFold model
P2Rank 0.939 · Pocket 1
FPocket 0.848 · Pocket 7
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 18 / 4744 genomes with a hit
Prevalence 0.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MDIINSIISLGASVMMPVIFFIIALCFGVKIGTAFKAGMLVGIGFEGVGLVIGLLLTNLGPASQAMVERIGLQLTVVDTGWPTASTIGWGSPLMLPVVVGFIVINLAMLLLKLTKTVNIDIFNYWIFLIMGSVVYAGTGNYWLSVGITFAIFVLTLLAADLTAPYLQKNYNLKGISFPHLTCIAYVPFGIACNYIIDKIPLINKINFDPESINKKFGVFGEPLTLGFVLGLLLAFLAGYDVSAAVSLAIKVSAAMLLLPKMIEILVQGLLIVRDAAEAKLKAKFPGRDFYIGMDTALLIGEPSVLATGLLLIPMAVVLSIILPGNRVLPFVDLASLMFLLAMVTPFCKRNMFRMFITGTLIVTCILYVGTDISQEYTQAAVNSHIPVPEGMAEITNIVGGATTPVGWLAVKFGEFFSATH

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

5
  • GO:0009401 The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0015577 Enables the transfer of a galactitol from one side of a membrane to the other. Galactitol is the hexitol derived by the reduction of the aldehyde group of either D- or L-galactose.
  • GO:0015796 The directed movement of galactitol across a membrane. Galactitol is the hexitol derived by the reduction of the aldehyde group of either D- or L-galactose.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

39 records
Show feature table
Start End DB Term Name
4 420 ProSiteProfiles PS51104 PTS_EIIC type-2 domain profile.
4 420 InterPro IPR013014 Phosphotransferase system, EIIC component, type 2
93 113 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
28 38 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
273 292 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
351 370 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
345 350 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
327 346 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
216 238 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 419 PIRSF PIRSF006304 GatC
1 419 InterPro IPR013853 Galactitol permease IIC component
114 124 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
293 321 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
145 164 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
298 320 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
7 29 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
370 420 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
39 61 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
216 239 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
6 27 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
158 176 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
251 272 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
7 381 Pfam PF03611 PTS system sugar-specific permease component
7 381 InterPro IPR004703 Phosphotransferase system, sugar-specific permease component
60 92 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
39 59 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
89 111 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
125 157 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
121 143 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
322 326 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
240 250 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
177 196 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 5 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
174 196 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
327 344 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
351 369 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
197 215 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
2 412 PANTHER PTHR37324 PTS SYSTEM GALACTITOL-SPECIFIC EIIC COMPONENT
2 412 InterPro IPR013853 Galactitol permease IIC component

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.934
Likely same site as FPocket 1 5.3 Å 15 shared residues 83% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.231
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.128
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.035
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.896
Likely same site as P2Rank 1 5.3 Å 15 shared residues 83% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GN52
AlphaFold DB — — full sequence — Viewing
ColabFold VK055_2303
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GN52