KpATCC43816 Protein target profile

gpt

Accession: VK055_2316

Gene: gpt AIK80920.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GSB1
Length 152
Pocket druggability (P2Rank · AlphaFold DB model) 0.229
Direct ligand evidence 0 67 total records
Functional annotation 1 EC 10 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
72.258 Higher values support similarity to known essential genes.
DEG E-value
1.71e-82 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
94.75 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.229
Structure A0A0H3GSB1
Pocket Pocket 1
Druggability (FPocket) 0.257
Structure A0A0H3GSB1
Pocket Pocket 9
ColabFold model
P2Rank 0.415 · Pocket 1
FPocket 0.28 · Pocket 11
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 168 / 4744 genomes with a hit
Prevalence 3.5%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSEKYVVTWDMLQIHARKLASRLLPVEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPIAGR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 10 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

10
  • GO:0000310 Catalysis of the reaction: diphosphate + XMP = 5-phospho-alpha-D-ribose 1-diphosphate + xanthine.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0052657 Catalysis of the reaction: GMP + diphosphate = guanine + 5-phospho-alpha-D-ribose 1-diphosphate.
  • GO:0004422 Catalysis of the reaction: IMP + diphosphate = hypoxanthine + 5-phospho-alpha-D-ribose 1-diphosphate.
  • GO:0000287 Binding to a magnesium (Mg) ion.
  • GO:0032263 Any process which produces guanosine monophosphate from derivatives of it, without de novo synthesis.
  • GO:0032264 Any process which produces inosine monophosphate from derivatives of it, without de novo synthesis.
  • GO:0006166 Any process which produces a purine nucleoside from derivatives of it, without de novo synthesis.
  • GO:0032265 Any process which produces xanthosine monophosphate from derivatives of it, without de novo synthesis.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
32 129 CDD cd06223 PRTases_typeI
32 129 InterPro IPR000836 Phosphoribosyltransferase domain
1 152 Hamap MF_01903 Xanthine-guanine phosphoribosyltransferase [gpt].
1 152 InterPro IPR023747 Xanthine-guanine phosphoribosyltransferase
4 144 SUPERFAMILY SSF53271 PRTase-like
4 144 InterPro IPR029057 Phosphoribosyltransferase-like
1 151 PANTHER PTHR39563 XANTHINE PHOSPHORIBOSYLTRANSFERASE
1 151 InterPro IPR023747 Xanthine-guanine phosphoribosyltransferase
1 152 Gene3D G3DSA:3.40.50.2020 -
1 152 InterPro IPR029057 Phosphoribosyltransferase-like
12 144 Pfam PF00156 Phosphoribosyl transferase domain
12 144 InterPro IPR000836 Phosphoribosyltransferase domain
1 152 FunFam G3DSA:3.40.50.2020:FF:000009 Xanthine phosphoribosyltransferase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.229
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.1
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #9
0.257
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:134-135
UniProt: Binding site:135-135
UniProt: Binding site:37-38
UniProt: Binding site:69-69
UniProt: Binding site:88-96
UniProt: Binding site:89-89
UniProt: Binding site:92-92
UniProt: Binding site:92-96
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GSB1
AlphaFold DB full sequence Viewing
ColabFold VK055_2316
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

67 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 17 records from similar proteins
Structural ligands 15 0 loaded crystals
Measured bioactivity 2 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
3L5 PDB via homolog 454.3 Da · LogP -1.62 · TPSA 217.1 Open detail RCSB PDB
3L7 PDB via homolog Detail RCSB PDB
3ZE PDB via homolog Detail RCSB PDB
3ZF PDB via homolog Detail RCSB PDB
5GP PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
3L5 RCSB PDB P0A9M2 454.3 Da LogP -1.62 TPSA 217.1 1 viol. ✓ Clean c1nc2c(n1CCN(CCOCCP(=O)(O)O)CCP(=O)(O)O)NC(=NC2…
3L7 RCSB PDB P0A9M2 437.3 Da LogP -0.74 TPSA 191.1 ✓ Ro5 ✓ Clean c1nc2c(n1CCN(CCO/C=C/P(=O)(O)O)CCP(=O)(O)O)N=CN…
3ZE RCSB PDB P0A9M5 358.3 Da LogP -2.38 TPSA 187.7 ✓ Ro5 ✓ Clean c1nc2c(n1[C@H]3CN(C[C@H]3O)C(=O)CP(=O)(O)O)N=C(…
3ZF RCSB PDB P0A9M5 342.3 Da LogP -1.35 TPSA 167.4 ✓ Ro5 ✓ Clean c1nc2c(n1[C@H]3CCN(C3)C(=O)CP(=O)(O)O)N=C(NC2=O…
5GP RCSB PDB P0A9M5 363.2 Da LogP -2.57 TPSA 206.0 1 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COP(=O)(O…
6W9 RCSB PDB P0A9M2 423.3 Da LogP -0.44 TPSA 181.9 ✓ Ro5 ✓ Clean c1nc2c(n1CCN(CCCCP(=O)(O)O)CCP(=O)(O)O)N=CNC2=O
6WA RCSB PDB P0A9M2 408.3 Da LogP 0.19 TPSA 179.8 1 viol. ✓ Clean c1c(c2c([nH]1)C(=O)NC=N2)CN(CCCP(=O)(O)O)CCCP(=…
6WB RCSB PDB P0A9M2 361.3 Da LogP -2.05 TPSA 164.8 ✓ Ro5 ✓ Clean c1nc2c(n1CCN(CCP(=O)(O)O)C[C@@H](CO)O)N=CNC2=O
6WC RCSB PDB P0A9M2 412.2 Da LogP -0.96 TPSA 197.1 ✓ Ro5 ✓ Clean c1nc2c(n1CC(COCP(=O)(O)O)COCP(=O)(O)O)N=CNC2=O
ADE RCSB PDB Q97W95 135.1 Da LogP -0.06 TPSA 80.5 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)c(ncn2)N
BO3 RCSB PDB P0A9M5 61.8 Da LogP -2.05 TPSA 60.7 ✓ Ro5 ✓ Clean B(O)(O)O
GUN RCSB PDB P0A9M5 151.1 Da LogP -0.77 TPSA 100.5 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)C(=O)NC(=N2)N
IMP RCSB PDB P0A9M2 348.2 Da LogP -2.15 TPSA 180.0 ✓ Ro5 ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COP(=O)(O…
PCP RCSB PDB P0A9M5 388.1 Da LogP -1.57 TPSA 220.5 1 viol. ✓ Clean C1[C@@H]([C@H]([C@H]([C@H]1O[P@](=O)(O)OP(=O)(O…
XAN RCSB PDB P0A9M5 152.1 Da LogP -1.06 TPSA 94.4 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)C(=O)NC(=O)N2

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.