KpATCC43816 Protein target profile

phosphoheptose isomerase

Accession: VK055_2330

Gene: AIK80934.1 gmhA 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A0H3GIQ6
Length 193
Pocket druggability (P2Rank · AlphaFold DB model) 0.061
Metabolic reactions 1
Chokepoint Yes
Direct ligand evidence 0 51 total records
Functional annotation 1 EC 7 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
6.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
92.708 Higher values support similarity to known essential genes.
DEG E-value
6.19e-134 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
97.8 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.061
Structure A0A0H3GIQ6
Pocket Pocket 1
Druggability (FPocket) 0.821
Structure A0A0H3GIQ6
Pocket Pocket 1
ColabFold model
P2Rank 0.02 · Pocket 1
FPocket 0.553 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 319 / 4744 genomes with a hit
Prevalence 6.7%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a producing chokepoint reaction in Biosynthesis of various nucleotide sugars, more central than 93.8% of genes in this genome, no human homolog detected.

Relative network centrality 93.8% more central than 93.8% of genes in this genome
Chokepoint Chokepoint gene
Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MYQDLIRNELNEAAETLANFLQDEANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHLSCVSNDFGYEYVFSRYVESVGRAGDVLLGISTSGNSGNVIKAIEAARAQGMKVITLTGKDGGKMAGSADVEIRVPHFGYADRIQEIHIKVIHILIMLIEKEMAKG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 7 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

7
  • GO:0097367 Binding to a carbohydrate derivative.
  • GO:1901135 The chemical reactions and pathways involving carbohydrate derivative.
  • GO:0008968 Catalysis of the reaction: D-sedoheptulose-7-phosphate = D-alpha,beta-D-heptose 7-phosphate.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0008270 Binding to a zinc ion (Zn).
  • GO:2001061 The chemical reactions and pathways resulting in the formation of a D-glycero-D-manno-heptose 7-phosphate.
  • GO:0009244 The chemical reactions and pathways resulting in the formation of the core region of bacterial lipopolysaccharides, which contains ten saccharide residues.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
1 190 Hamap MF_00067 Phosphoheptose isomerase [gmhA].
1 190 InterPro IPR004515 Phosphoheptose isomerase
1 192 Gene3D G3DSA:3.40.50.10490 -
35 187 NCBIfam TIGR00441 D-sedoheptulose 7-phosphate isomerase
35 187 InterPro IPR004515 Phosphoheptose isomerase
12 146 Pfam PF13580 SIS domain
12 146 InterPro IPR001347 SIS domain
10 188 CDD cd05006 SIS_GmhA
10 188 InterPro IPR035461 GmhA/DiaA
1 189 SUPERFAMILY SSF53697 SIS domain
1 189 InterPro IPR046348 SIS domain superfamily
37 193 ProSiteProfiles PS51464 SIS domain profile.
37 193 InterPro IPR001347 SIS domain
1 192 PANTHER PTHR30390 SEDOHEPTULOSE 7-PHOSPHATE ISOMERASE / DNAA INITIATOR-ASSOCIATING FACTOR FOR REPLICATION INITIATION
1 192 FunFam G3DSA:3.40.50.10490:FF:000013 Phosphoheptose isomerase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.061
Likely same site as FPocket 6 1.3 Å 7 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.035
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.01
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.821
Show in viewer
Surrounding area
Pocket 2 FPocket #6
0.384
Likely same site as P2Rank 1 1.3 Å 7 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 FPocket #8
0.344
Likely same site as P2Rank 1 7.1 Å 2 shared residues 40% of smaller site
Show in viewer
Surrounding area
Pocket 4 FPocket #2
0.274
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:119-121
UniProt: Binding site:124-124
UniProt: Binding site:172-172
UniProt: Binding site:180-180
UniProt: Binding site:52-54
UniProt: Binding site:61-61
UniProt: Binding site:65-65
UniProt: Binding site:93-94
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GIQ6
AlphaFold DB full sequence Viewing
ColabFold VK055_2330
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 1 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
I22 PDB via homolog 290.2 Da · LogP -3.90 · TPSA 185.0 Open detail RCSB PDB
ZINC5132038 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC100065511 ZINC proposed compound · Tanimoto 0.897 Detail ZINC
ZINC100085043 ZINC proposed compound · Tanimoto 0.897 Detail ZINC
ZINC104869937 ZINC proposed compound · Tanimoto 0.897 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
I22 RCSB PDB P63224 290.2 Da LogP -3.90 TPSA 185.0 1 viol. ✓ Clean C([C@H]([C@H]([C@H]([C@@H](C(=O)CO)O)O)O)O)OP(=…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.