KpATCC43816 Protein target profile

di-trans,poly-cis-decaprenylcistransferase

Accession: VK055_2378

Gene: AIK80975.1 uppS 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A0H3GS37
Length 252
Pocket druggability (P2Rank · AlphaFold DB model) 0.958
Metabolic reactions 1
Chokepoint No
Direct ligand evidence 0 71 total records
Functional annotation 1 EC 8 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
42.857 Lower values reduce human off-target concern.
Human E-value
3.12e-10
Gut microbiome similarity
7.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
88.095 Higher values support similarity to known essential genes.
DEG E-value
3.38e-168 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
92.96 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.958
Structure A0A0H3GS37
Pocket Pocket 1
Druggability (FPocket) 0.863
Structure A0A0H3GS37
Pocket Pocket 1
ColabFold model
P2Rank 0.955 · Pocket 1
FPocket 0.989 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 371 / 4744 genomes with a hit
Prevalence 7.8%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Metabolic context: more central than 94.4% of genes in this genome.

Relative network centrality 94.4% more central than 94.4% of genes in this genome
Chokepoint Not a chokepoint
Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MLSANQTVSEISPTHGCRHVAIIMDGNGRWAKRQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTTRFNARLQERIRKAEALTANNTGLTLNIAANYGGRWDITQGVRLLAKQVQDGTLLPEQITEDMLSQQVCMHELAPVDLVIRTGGEHRISNFLIWQIAYAELYFTDVLWPDFAEQDFEGALHAFVNRERRFGGTEPGGSHA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 8 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

8
  • GO:0016765 Catalysis of the transfer of an alkyl or aryl (but not methyl) group from one compound (donor) to another (acceptor).
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0008834 Catalysis of the reaction: (2E,6E)-farnesyl diphosphate + 8 isopentenyl diphosphate = di-trans,octa-cis-undecaprenyl diphosphate + 8 diphosphate.
  • GO:0000287 Binding to a magnesium (Mg) ion.
  • GO:0071555 A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
  • GO:0009252 The chemical reactions and pathways resulting in the formation of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls and consisting of long glycan strands of alternating residues of beta-(1,4) linked N-acetylglucosamine and N-acetylmuramic acid, cross-linked by short peptides.
  • GO:0016094 The chemical reactions and pathways resulting in the formation of polyprenols, prenols with more than 4 isoprenoid residues, which may be all-trans, or a mixture of cis and trans.
  • GO:0008360 Any process that modulates the surface configuration of a cell.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
16 243 PANTHER PTHR10291 DEHYDRODOLICHYL DIPHOSPHATE SYNTHASE FAMILY MEMBER
16 243 InterPro IPR001441 Decaprenyl diphosphate synthase-like
2 245 Gene3D G3DSA:3.40.1180.10 -
2 245 InterPro IPR036424 Decaprenyl diphosphate synthase-like superfamily
18 243 NCBIfam TIGR00055 polyprenyl diphosphate synthase
18 243 InterPro IPR001441 Decaprenyl diphosphate synthase-like
16 244 Hamap MF_01139 Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) [uppS].
16 244 InterPro IPR001441 Decaprenyl diphosphate synthase-like
18 239 SUPERFAMILY SSF64005 Undecaprenyl diphosphate synthase
18 239 InterPro IPR036424 Decaprenyl diphosphate synthase-like superfamily
19 235 CDD cd00475 Cis_IPPS
19 235 InterPro IPR001441 Decaprenyl diphosphate synthase-like
189 206 ProSitePatterns PS01066 Undecaprenyl pyrophosphate synthase family signature.
189 206 InterPro IPR018520 Di-trans-poly-cis-decaprenylcistransferase-like, conserved site
23 243 Pfam PF01255 Putative undecaprenyl diphosphate synthase
23 243 InterPro IPR001441 Decaprenyl diphosphate synthase-like
5 245 FunFam G3DSA:3.40.1180.10:FF:000001 (2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.958
Likely same site as FPocket 1 4.9 Å 29 shared residues 85% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.067
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.052
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.863 Unusual size
Likely same site as P2Rank 1 4.9 Å 29 shared residues 85% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:31-31
UniProt: Active site:79-79 Proton acceptor
UniProt: Binding site:199-199
UniProt: Binding site:204-204
UniProt: Binding site:205-207
UniProt: Binding site:218-218
UniProt: Binding site:31-31
UniProt: Binding site:32-35
UniProt: Binding site:36-36
UniProt: Binding site:44-44
UniProt: Binding site:48-48
UniProt: Binding site:76-78
UniProt: Binding site:80-80
UniProt: Binding site:82-82
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GS37
AlphaFold DB full sequence Viewing
ColabFold VK055_2378
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

71 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 21 records from similar proteins
Structural ligands 4 0 loaded crystals
Measured bioactivity 17 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
53Q PDB via homolog 406.0 Da · LogP 6.56 · TPSA 12.5 Open detail RCSB PDB
DPO PDB via homolog Detail RCSB PDB
H78 PDB via homolog Detail RCSB PDB
V0D PDB via homolog Detail RCSB PDB
CHEMBL272547 ChEMBL via homolog · pchembl 7.40 (~39.8 nM) Detail ChEMBL

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
53Q RCSB PDB O31751 406.0 Da LogP 6.56 TPSA 12.5 1 viol. ✓ Clean CCN(CC)CCOc1ccc(cc1)/C(=C(\c2ccccc2)/Cl)/c3cccc…
DPO RCSB PDB P55984 173.9 Da LogP -3.34 TPSA 135.6 ✓ Ro5 ✓ Clean [O-]P(=O)([O-])OP(=O)([O-])[O-]
H78 RCSB PDB P60472 948.7 Da LogP 3.71 TPSA 362.9 2 viol. ✓ Clean c1cc(cc(c1)c2cccc(c2)NS(=O)(=O)c3cccc(c3)S(=O)(…
V0D RCSB PDB O31751 338.4 Da LogP 4.48 TPSA 33.4 ✓ Ro5 ✓ Clean CCc1cc(n2c(n1)c(cn2)c3ccc(cc3)F)N4CCCCCC4

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.