KpATCC43816 Protein target profile

RNA polymerase-binding protein DksA

Accession: VK055_2423

Gene: dksA AIK81020.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GIE5
Length 151
Pocket druggability (FPocket · AlphaFold DB model) 0.247
Direct ligand evidence 0 51 total records
Functional annotation 0 EC 3 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
85.417 Higher values support similarity to known essential genes.
DEG E-value
8.239999999999999e-92 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
89.67 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank)
Structure A0A0H3GIE5
Pocket No pockets
Druggability (FPocket) 0.247
Structure A0A0H3GIE5
Pocket Pocket 10
ColabFold model
FPocket 0.256 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 185 / 4744 genomes with a hit
Prevalence 3.9%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFKRILEAWRNQLRDEVDRTVSHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

3
  • GO:0008270 Binding to a zinc ion (Zn).
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0010468 Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product (protein or RNA).

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

21 records
Show feature table
Start End DB Term Name
114 138 ProSitePatterns PS01102 Prokaryotic dksA C4-type zinc finger.
114 138 InterPro IPR020458 Zinc finger, DksA/TraR C4-type conserved site
28 150 Hamap MF_00926 RNA polymerase-binding transcription factor DksA [dksA].
28 150 InterPro IPR012784 RNA polymerase-binding transcription factor DksA
1 151 Gene3D G3DSA:1.20.120.910 -
71 151 ProSiteProfiles PS51128 Prokaryotic dksA C4-type zinc finger profiles.
71 151 InterPro IPR000962 Zinc finger, DksA/TraR C4-type
9 109 SUPERFAMILY SSF109635 DnaK suppressor protein DksA, alpha-hairpin domain
9 109 InterPro IPR037187 DksA, N-terminal domain superfamily
110 143 Pfam PF01258 Prokaryotic dksA/traR C4-type zinc finger
110 143 InterPro IPR000962 Zinc finger, DksA/TraR C4-type
32 149 PANTHER PTHR33823 RNA POLYMERASE-BINDING TRANSCRIPTION FACTOR DKSA-RELATED
111 149 SUPERFAMILY SSF57716 Glucocorticoid receptor-like (DNA-binding domain)
126 138 PRINTS PR00618 DksA/TraR zinc finger signature
126 138 InterPro IPR020460 Zinc finger, DksA/TraR C4-type, bacteria
114 125 PRINTS PR00618 DksA/TraR zinc finger signature
114 125 InterPro IPR020460 Zinc finger, DksA/TraR C4-type, bacteria
32 140 NCBIfam TIGR02420 RNA polymerase-binding protein DksA
32 140 InterPro IPR012784 RNA polymerase-binding transcription factor DksA
1 151 FunFam G3DSA:1.20.120.910:FF:000001 RNA polymerase-binding transcription factor DksA
89 109 Coils Coil Coil

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #10
0.247
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:114-114
UniProt: Binding site:117-117
UniProt: Binding site:135-135
UniProt: Binding site:138-138
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GIE5
AlphaFold DB full sequence Viewing
ColabFold VK055_2423
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 1 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
G4P PDB via homolog 603.2 Da · LogP -2.22 · TPSA 345.6 Open detail RCSB PDB
ZINC104869865 ZINC proposed compound · Tanimoto 0.836 Detail ZINC
ZINC12504289 ZINC proposed compound · Tanimoto 0.836 Detail ZINC
ZINC34541308 ZINC proposed compound · Tanimoto 0.836 Detail ZINC
ZINC35000839 ZINC proposed compound · Tanimoto 0.836 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
G4P RCSB PDB P0ABS1 603.2 Da LogP -2.22 TPSA 345.6 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.