KpATCC43816 Protein target profile

2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase

Accession: VK055_2426

Gene: folK AIK81023.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 2 reactions UniProt A0A0H3GNE6
Length 159
Pocket druggability (P2Rank · AlphaFold DB model) 0.669
Metabolic reactions 2
Chokepoint Yes
Direct ligand evidence 0 99 total records
Functional annotation 1 EC 6 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
79.245 Higher values support similarity to known essential genes.
DEG E-value
2.83e-93 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
96.38 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.669
Structure A0A0H3GNE6
Pocket Pocket 1
Druggability (FPocket) 0.288
Structure A0A0H3GNE6
Pocket Pocket 1
ColabFold model
P2Rank 0.808 · Pocket 1
FPocket 0.45 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 157 / 4744 genomes with a hit
Prevalence 3.3%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a producing & consuming chokepoint reaction in Folate biosynthesis, no isoenzyme backup detected, more central than 90.1% of genes in this genome, no human homolog detected.

Relative network centrality 90.1% more central than 90.1% of genes in this genome
Chokepoint Chokepoint gene
Catalyzed reactions

2 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MTLVYIALGSNLASPLEQVQAAIRALGEIPHSRVVAVSSFYRTPPLGPQDQPDYLNAAVALETALPPETLLDHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDAVINSERLTVPHYDMKNRGFMLWPLFEIAPDLHFPDGPALRAVLDNLGVEKPASW

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0003848 Catalysis of the reaction: 2-amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropteridine + ATP = (2-amino-4-hydroxy-7,8-dihydropteridin-6-yl)methyl diphosphate + AMP + 2 H+.
  • GO:0009396 The chemical reactions and pathways resulting in the formation of folic acid and its derivatives.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0016301 Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
  • GO:0046656 The chemical reactions and pathways resulting in the formation of folic acid, pteroylglutamic acid.
  • GO:0046654 The chemical reactions and pathways resulting in the formation of tetrahydrofolate, 5,6,7,8-tetrahydrofolic acid, a folate derivative bearing additional hydrogens on the pterin group.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
1 151 PANTHER PTHR43071 2-AMINO-4-HYDROXY-6-HYDROXYMETHYLDIHYDROPTERIDINE PYROPHOSPHOKINASE
1 149 SUPERFAMILY SSF55083 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK
1 149 InterPro IPR035907 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK superfamily
2 159 FunFam G3DSA:3.30.70.560:FF:000001 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
4 134 NCBIfam TIGR01498 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
4 134 InterPro IPR000550 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK
2 158 Gene3D G3DSA:3.30.70.560 -
2 158 InterPro IPR035907 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK superfamily
89 100 ProSitePatterns PS00794 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase signature.
89 100 InterPro IPR000550 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK
4 132 CDD cd00483 HPPK
4 132 InterPro IPR000550 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK
5 134 Pfam PF01288 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
5 134 InterPro IPR000550 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.669
Likely same site as FPocket 1 4.8 Å 8 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.006
Likely same site as FPocket 5 3.2 Å 7 shared residues 78% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.288
Likely same site as P2Rank 1 4.8 Å 8 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #5
0.261
Likely same site as P2Rank 2 3.2 Å 7 shared residues 78% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GNE6
AlphaFold DB full sequence Viewing
ColabFold VK055_2426
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

99 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 49 records from similar proteins
Structural ligands 28 0 loaded crystals
Measured bioactivity 21 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
5RW PDB via homolog 291.3 Da · LogP 1.66 · TPSA 100.5 Open detail RCSB PDB
5RX PDB via homolog Detail RCSB PDB
5RY PDB via homolog Detail RCSB PDB
5RZ PDB via homolog Detail RCSB PDB
87Y PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
5RW RCSB PDB Q2G0Q5 291.3 Da LogP 1.66 TPSA 100.5 ✓ Ro5 ✓ Clean c1cc(ccc1CSc2[nH]c3c(n2)N=C(NC3=O)N)F
5RX RCSB PDB Q2G0Q5 307.8 Da LogP 2.17 TPSA 100.5 ✓ Ro5 ✓ Clean c1cc(ccc1CSc2[nH]c3c(n2)C(=O)NC(=N3)N)Cl
5RY RCSB PDB Q2G0Q5 316.3 Da LogP 1.53 TPSA 124.2 ✓ Ro5 ✓ Clean c1cc(c(cc1C#N)F)CSc2[nH]c3c(n2)C(=O)NC(=N3)N
5RZ RCSB PDB Q2G0Q5 380.2 Da LogP 1.97 TPSA 117.5 ✓ Ro5 ✓ Clean c1cc(ccc1C(=O)CSc2[nH]c3c(n2)C(=O)NC(=N3)N)Br
87Y RCSB PDB P26281 313.4 Da LogP 1.23 TPSA 116.4 ✓ Ro5 ✓ Clean C[C@@]1(C(=NC2=C(N1)N=C(NC2=O)N)CO)CCc3ccccc3
A4P RCSB PDB P26281 764.3 Da LogP -1.62 TPSA 410.8 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
APC RCSB PDB A0A5P8YCA3 505.2 Da LogP -1.52 TPSA 269.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
DX4 RCSB PDB P26281 167.2 Da LogP 0.60 TPSA 83.4 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)C(=S)NC(=N2)N
H73 RCSB PDB P26281 672.7 Da LogP -1.56 TPSA 285.1 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)C(=O)NCCN3CC[C@H](C…
HH2 RCSB PDB P26281 353.1 Da LogP -0.98 TPSA 210.8 ✓ Ro5 ✓ Clean c1c(nc2c(n1)N=C(NC2=O)N)CO[P@](=O)(O)OP(=O)(O)O
HHR RCSB PDB P26281 193.2 Da LogP -1.21 TPSA 117.8 ✓ Ro5 ✓ Clean c1c(nc2c(n1)N=C(NC2=O)N)CO
HHS RCSB PDB P26281 207.1 Da LogP -1.01 TPSA 134.8 ✓ Ro5 ✓ Clean c1c(nc2c(n1)N=C(NC2=O)N)C(=O)O
J1A RCSB PDB P26281 584.7 Da LogP -1.38 TPSA 232.1 3 viol. ✓ Clean c1c(nc2c(n1)N=C(NC2=O)N)CNCCN3CCC(CC3)SC[C@@H]4…
J1B RCSB PDB P26281 614.7 Da LogP -0.54 TPSA 230.7 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)CNCCN3CCC(CC3)SC[C@…
J1C RCSB PDB P26281 628.7 Da LogP -1.02 TPSA 247.8 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)C(=O)NCCN3CCC(CC3)S…
J1D RCSB PDB P26281 634.6 Da LogP -3.68 TPSA 307.8 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)C(=O)NCC(=O)NCCS(=O…
J1F RCSB PDB P26281 693.6 Da LogP -4.13 TPSA 351.5 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)C(=O)NCC(=O)N(CC(=O…
J1I RCSB PDB P26281 682.7 Da LogP -2.04 TPSA 305.3 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)C(=O)NCCN(CCSC[C@@H…
J1L RCSB PDB P26281 704.7 Da LogP -2.88 TPSA 319.2 3 viol. ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)C(=O)NCCN3CC[C@H](C…
PH2 RCSB PDB A0A5P8YCA3 195.2 Da LogP -1.16 TPSA 116.4 ✓ Ro5 ✓ Clean C1C(=NC2=C(N1)N=C(NC2=O)N)CO
ROI RCSB PDB P43777 209.2 Da LogP 0.14 TPSA 116.4 ✓ Ro5 ✓ Clean CC1(C(=NC2=C(N1)N=C(NC2=O)N)O)C
YH1 RCSB PDB P26281 301.3 Da LogP 1.20 TPSA 117.5 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)CSc2[nH]c3c(n2)C(=O)NC(=N3)N
YH2 RCSB PDB Q2G0Q5 298.3 Da LogP 1.39 TPSA 124.2 ✓ Ro5 ✓ Clean c1cc(ccc1CSc2[nH]c3c(n2)C(=O)NC(=N3)N)C#N
YH3 RCSB PDB P26281 315.4 Da LogP 1.51 TPSA 117.5 ✓ Ro5 ✓ Clean Cc1cccc(c1)C(=O)CSc2[nH]c3c(n2)C(=O)NC(=N3)N
YH4 RCSB PDB P26281 315.4 Da LogP 1.51 TPSA 117.5 ✓ Ro5 ✓ Clean Cc1ccccc1C(=O)CSc2[nH]c3c(n2)N=C(NC3=O)N
YH5 RCSB PDB P26281 331.4 Da LogP 1.21 TPSA 126.8 ✓ Ro5 ✓ Clean COc1ccc(cc1)C(=O)CSc2[nH]c3c(n2)C(=O)NC(=N3)N
YH6 RCSB PDB P26281 315.4 Da LogP 1.51 TPSA 117.5 ✓ Ro5 ✓ Clean Cc1ccc(cc1)C(=O)CSc2[nH]c3c(n2)N=C(NC3=O)N
YH7 RCSB PDB P26281 167.2 Da LogP 0.60 TPSA 83.4 ✓ Ro5 ✓ Clean C1=NC2=C(NC(=S)N=C2N1)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.