KpATCC43816 Protein target profile

cell division protein FtsQ

Accession: VK055_2474

Gene: AIK81071.1 ftsQ 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GN94
Length 276
Pocket druggability (P2Rank · AlphaFold DB model) 0.049
Direct ligand evidence 0 52 total records
Functional annotation 0 EC 4 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
89.057 Higher values support similarity to known essential genes.
DEG E-value
3.73e-169 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
85.18 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.049
Structure A0A0H3GN94
Pocket Pocket 1
Druggability (FPocket) 0.438
Structure A0A0H3GN94
Pocket Pocket 3
ColabFold model
P2Rank 0.086 · Pocket 1
FPocket 0.444 · Pocket 2
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 109 / 4744 genomes with a hit
Prevalence 2.3%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSQAALNTRNHEEEASSSRRSNGTRLAGIVFLLAVLFTVLVSGWMVLGWMEDAQRLPLSKMVVTGERHYTRNDDIRQAILALGSPGTFMTQDVNIIQSQIERLPWIKQASVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNAFSVPADRTSKQNLPMLYGPEGSENEVLQGYRDMGQVLAKDKFTLKVAAMTARRSWQLTLNNDIKLNLGRGDTMKRLQRFMELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWVPAPTEETNQQQNQAQAEQQ

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
Unknown

Gene Ontology (GO)

4
  • GO:0090529 The assembly and arrangement of a cellular component that is composed of peptidoglycan and often chitin in addition to other materials and usually forms perpendicular to the long axis of a cell or hypha. It grows centripetally from the cell wall to the center of the cell and often functions in the compartmentalization of a cell into two daughter cells.
  • GO:0032153 The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0043093 A cytokinesis process that involves a set of conserved proteins including FtsZ, and results in the formation of two similarly sized and shaped cells.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
57 126 Pfam PF08478 POTRA domain, FtsQ-type
57 126 InterPro IPR013685 POTRA domain, FtsQ-type
26 50 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
26 48 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 25 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
130 247 Pfam PF03799 Cell division protein FtsQ/DivIB, C-terminal
130 247 InterPro IPR005548 Cell division protein FtsQ/DivIB, C-terminal
51 276 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
58 126 Gene3D G3DSA:3.10.20.310 membrane protein fhac
127 258 Gene3D G3DSA:3.40.50.11690 Cell division protein FtsQ/DivIB
127 258 InterPro IPR045335 Cell division protein FtsQ, C-terminal
56 126 ProSiteProfiles PS51779 POTRA domain profile.
56 126 InterPro IPR034746 POTRA domain
127 259 FunFam G3DSA:3.40.50.11690:FF:000001 Cell division protein FtsQ
26 255 Hamap MF_00911 Cell division protein FtsQ [ftsQ].
26 255 InterPro IPR026579 Cell division protein FtsQ
1 268 PANTHER PTHR35851 CELL DIVISION PROTEIN FTSQ
1 268 InterPro IPR026579 Cell division protein FtsQ

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.049
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.017
Likely same site as FPocket 1 6.7 Å 6 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #3
0.438
Show in viewer
Surrounding area
Pocket 2 FPocket #1
0.373 Unusual size
Likely same site as P2Rank 2 6.7 Å 6 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 FPocket #6
0.324
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GN94
AlphaFold DB full sequence Viewing
ColabFold VK055_2474
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
PEV PDB via homolog 720.0 Da · LogP 11.28 · TPSA 134.4 Open detail RCSB PDB
PGV PDB via homolog Detail RCSB PDB
ZINC102190506 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC102190512 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC27416437 ZINC proposed compound · Tanimoto 0.976 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
PEV RCSB PDB Q8X9Y5 720.0 Da LogP 11.28 TPSA 134.4 2 viol. ✓ Clean CCCCCCCCCCCCCCCCCC(=O)O[C@@H](COC(=O)CCCCCCCCCC…
PGV RCSB PDB Q8X9Y5 749.0 Da LogP 10.45 TPSA 148.8 2 viol. ✓ Clean CCCCCCCCCCCCCCCC(=O)OC[C@H](CO[P@](=O)(O)OC[C@H…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.