KpATCC43816 Protein target profile

lipoate-protein ligase A

Accession: VK055_2590

Gene: lplA AIK81187.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 10 reactions UniProt A0A0H3GMX6
Length 338
Pocket druggability (P2Rank · AlphaFold DB model) 0.886
Metabolic reactions 10
Chokepoint Yes
Direct ligand evidence 0 56 total records
Functional annotation 1 EC 6 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
51.351 Lower values reduce human off-target concern.
Human E-value
1.71e-17
Gut microbiome similarity
2.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
89.349 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
92.31 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.886
Structure A0A0H3GMX6
Pocket Pocket 1
Druggability (FPocket) 0.422
Structure A0A0H3GMX6
Pocket Pocket 1
ColabFold model
P2Rank 0.946 · Pocket 1
FPocket 0.942 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 118 / 4744 genomes with a hit
Prevalence 2.5%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network

Attractive metabolic target: catalyzes a producing chokepoint reaction in Lipoic acid metabolism, more central than 93.2% of genes in this genome.

Relative network centrality 93.2% more central than 93.2% of genes in this genome
Chokepoint Chokepoint gene
Catalyzed reactions

10 reactions mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSTLRLLLSDSYDPWFNLAVEECIFRQMPATQRVLFLWRNADTVVIGRAQNPWKECNTRRMEEDHVRLARRSSGGGAVFHDLGNTCFTFMAGKPEYDKTVSTAIVLTALNSLGVTAEASGRNDLVVKTDSGDRKVSGSAYRETMDRGFHHGTLLLNADLSRLANYLNPDQKKLQAKGITSVRGRVANLVELLPGITHQQVCEAIQEAFFSHYGERVDAEVISPDNTPDLPNFAETFARQSSWEWNFGQAPAFSHLLDERFRWGCVELHFDVEKGHITRAQAFTDSLNPAPLEALAARLVGCQYRAEVLQQQCEALVGDFPEQEAELKELSAWIAGAVR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0016979 Catalysis of the lipoylation of a protein in two steps: ATP + (R)-lipoate + a [lipoyl-carrier protein]-L-lysine = a [lipoyl-carrier protein]-N6-(lipoyl)lysine + AMP + diphosphate (overall reaction): (1) ATP + (R)-lipoate = lipoyl-AMP + diphosphate; (2) lipoyl-AMP + a [lipoyl-carrier protein]-L-lysine = a [lipoyl-carrier protein]-N6-(lipoyl)lysine + AMP.
  • GO:0009249 The lipoylation of peptidyl-lysine to form peptidyl-N6-lipoyl-L-lysine.
  • GO:0036211 The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications). Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0017118 Catalysis of the reaction: (R)-lipoyl-5'-AMP + L-lysyl-[lipoyl-carrier protein] = (R)-N6-lipoyl-L-lysyl-[lipoyl-carrier protein] + AMP + 2 H+.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

20 records
Show feature table
Start End DB Term Name
5 208 CDD cd16443 LplA
250 333 Pfam PF10437 Bacterial lipoate protein ligase C-terminus
250 333 InterPro IPR019491 Lipoate protein ligase, C-terminal
1 338 Hamap MF_01602 Lipoate-protein ligase A [lplA].
1 338 InterPro IPR023741 Lipoate-protein ligase A
6 334 PANTHER PTHR12561 LIPOATE-PROTEIN LIGASE
6 334 InterPro IPR004562 Lipoyltransferase/lipoate-protein ligase
2 329 NCBIfam TIGR00545 lipoate--protein ligase
2 329 InterPro IPR004562 Lipoyltransferase/lipoate-protein ligase
3 247 SUPERFAMILY SSF55681 Class II aaRS and biotin synthetases
3 247 InterPro IPR045864 Class II Aminoacyl-tRNA synthetase/Biotinyl protein ligase (BPL) and lipoyl protein ligase (LPL)
2 249 Gene3D G3DSA:3.30.930.10 Bira Bifunctional Protein; Domain 2
2 249 InterPro IPR045864 Class II Aminoacyl-tRNA synthetase/Biotinyl protein ligase (BPL) and lipoyl protein ligase (LPL)
2 249 FunFam G3DSA:3.30.930.10:FF:000024 Lipoate-protein ligase A
29 216 ProSiteProfiles PS51733 Biotinyl protein ligase (BPL) and lipoyl protein ligase (LPL) catalytic domain profile.
29 216 InterPro IPR004143 Biotinyl protein ligase (BPL) and lipoyl protein ligase (LPL), catalytic domain
52 158 Pfam PF03099 Biotin/lipoate A/B protein ligase family
52 158 InterPro IPR004143 Biotinyl protein ligase (BPL) and lipoyl protein ligase (LPL), catalytic domain
250 338 Gene3D G3DSA:3.30.390.50 -
248 335 SUPERFAMILY SSF82649 SufE/NifU

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.886
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.386
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.116
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.028
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.003
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.422
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:134-134
UniProt: Binding site:71-71
UniProt: Binding site:76-79
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GMX6
AlphaFold DB full sequence Viewing
ColabFold VK055_2590
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

56 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 6 records from similar proteins
Structural ligands 6 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
37P PDB via homolog 641.6 Da · LogP 0.13 · TPSA 255.1 Open detail RCSB PDB
37R PDB via homolog Detail RCSB PDB
LAQ PDB via homolog Detail RCSB PDB
OCT PDB via homolog Detail RCSB PDB
SH5 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
37P RCSB PDB P32099 641.6 Da LogP 0.13 TPSA 255.1 2 viol. ✓ Clean c1cc2c(cc1O)OC3=CC(=O)C(=CC3=N2)CCCCC(=O)NS(=O)…
37R RCSB PDB P32099 314.3 Da LogP 3.15 TPSA 104.8 ✓ Ro5 ✓ Clean c1cc2c(cc1O)Oc3cc(c(cc3N2)CCCCC(=O)N)O
LAQ RCSB PDB P32099 535.5 Da LogP 1.40 TPSA 192.1 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
OCT RCSB PDB P32099 114.2 Da LogP 3.37 TPSA 0.0 ✓ Ro5 ✓ Clean CCCCCCCC
SH5 RCSB PDB Q830N7 552.3 Da LogP 1.42 TPSA 192.1 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
SH6 RCSB PDB Q830N7 223.1 Da LogP 2.81 TPSA 37.3 ✓ Ro5 ✓ Clean C(CCCC(=O)O)CCCBr

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.