Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 0.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 43.056 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 92.73 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MELTAVPATQFSSVQLTDILNACFEAYLVPVTQSVEGFVQRFSAEGMSLVDSRVWLAGDKPAAIAIVARRGSAARLAAFALRPAWRGKGLGRKLMQELLMLLQQQGIETVYLEVIRDNHAAVALYQSLGFTRRYGLCGYLSTELLAPVPGVLQLYPTLSLLRRAIEESNSQLPWLLDPLTFATLPCQVVTLEQRAFAVLTTAGSRPVLSFLWVEPAARRQGLARELLMALAQEFPGIGTSVTVPETFTPLFAAAGYAALTLQQYEMSATMNALRSAGR
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Gene Ontology (GO)
1- GO:0016747 Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 15 | 133 | SUPERFAMILY | SSF55729 | Acyl-CoA N-acyltransferases (Nat) |
| 15 | 133 | InterPro | IPR016181 | Acyl-CoA N-acyltransferase |
| 2 | 141 | Gene3D | G3DSA:3.40.630.30 | - |
| 51 | 130 | Pfam | PF00583 | Acetyltransferase (GNAT) family |
| 51 | 130 | InterPro | IPR000182 | GNAT domain |
| 195 | 234 | CDD | cd04301 | NAT_SF |
| 64 | 146 | PANTHER | PTHR43420 | ACETYLTRANSFERASE |
| 3 | 149 | ProSiteProfiles | PS51186 | Gcn5-related N-acetyltransferase (GNAT) domain profile. |
| 3 | 149 | InterPro | IPR000182 | GNAT domain |
| 189 | 256 | SUPERFAMILY | SSF55729 | Acyl-CoA N-acyltransferases (Nat) |
| 189 | 256 | InterPro | IPR016181 | Acyl-CoA N-acyltransferase |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GIP5
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_2637
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CMC RCSB PDB | O74311 | 825.6 Da LogP -1.78 TPSA 383.9 | 3 viol. | ✓ Clean |
CC(C)(CO[P@](=O)(O)O[P@@](=O)(O)OC[C@@H]1[C@H](…
|
|
| IHP RCSB PDB | O74311 | 660.0 Da LogP -3.13 TPSA 400.6 | 3 viol. | ✓ Clean |
C1(C(C(C(C(C1OP(=O)(O)O)OP(=O)(O)O)OP(=O)(O)O)O…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC13556870 ZINC | 0.722 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@@H](O)[C@H](O)[C@@H…
|
| ZINC71789368 ZINC | 0.722 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@H](OP(=O)(O)O)[C@@H](O)[C@H]…
|
| ZINC71792243 ZINC | 0.722 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H…
|
| ZINC100015956 ZINC | 0.706 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@H](O)[C@@H](OP(=O)(O)O)[C@H]…
|
| ZINC100015959 ZINC | 0.706 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@H](O)[C@@H](OP(=O)(O)O)[C@H]…
|
| ZINC100016166 ZINC | 0.706 | 340.1 Da LogP -3.60 TPSA 214.4 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](OP(=O…
|
| ZINC100590871 ZINC | 0.706 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@H](O)[C@H](OP(=O)(O)O)[C@H](…
|
| ZINC1501016356 ZINC | 0.706 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)OC1C(O)[C@H](OP(=O)(O)O)C(O)[C@H](OP(=…
|
| ZINC100016164 ZINC | 0.667 | 260.1 Da LogP -3.72 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](O)[C@…
|
| ZINC100028278 ZINC | 0.667 | 260.1 Da LogP -3.72 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@@H](O)[C@H](O)[C@@H…
|
| ZINC100061358 ZINC | 0.667 | 260.1 Da LogP -3.72 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H]…
|
| ZINC100085584 ZINC | 0.667 | 260.1 Da LogP -3.72 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@H]…
|
| ZINC100604895 ZINC | 0.667 | 260.1 Da LogP -3.72 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@@H](O)[C@H](O)[C@H](O)[C@@H…
|
| ZINC100620447 ZINC | 0.667 | 260.1 Da LogP -3.72 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H…
|
| ZINC13536447 ZINC | 0.667 | 340.1 Da LogP -3.60 TPSA 214.4 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H]…
|
| ZINC2504621 ZINC | 0.667 | 260.1 Da LogP -3.72 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC1[C@@H](O)[C@H](O)C(O)[C@@H](O)[C@H]…
|
| ZINC255979099 ZINC | 0.667 | 260.1 Da LogP -3.72 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@@H](O)[C@@H](O)[C@H](O)[C@@…
|
| ZINC3869170 ZINC | 0.667 | 260.1 Da LogP -3.72 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC1[C@@H](O)[C@@H](O)C(O)[C@@H](O)[C@H…
|
| ZINC3869171 ZINC | 0.667 | 260.1 Da LogP -3.72 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC1[C@H](O)[C@@H](O)C(O)[C@@H](O)[C@H]…
|
| ZINC3869172 ZINC | 0.667 | 260.1 Da LogP -3.72 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC1[C@H](O)[C@H](O)C(O)[C@@H](O)[C@H]1O
|
| ZINC4096301 ZINC | 0.667 | 340.1 Da LogP -3.60 TPSA 214.4 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](O)[C@…
|
| ZINC100016181 ZINC | 0.632 | 340.1 Da LogP -3.60 TPSA 214.4 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@H](O)[C@H](OP(=O)(O)O)[C@@H…
|
| ZINC100017679 ZINC | 0.632 | 340.1 Da LogP -3.60 TPSA 214.4 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@H]…
|
| ZINC100032685 ZINC | 0.632 | 340.1 Da LogP -3.60 TPSA 214.4 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H]…
|
| ZINC100079962 ZINC | 0.632 | 340.1 Da LogP -3.60 TPSA 214.4 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@…
|
| ZINC100096885 ZINC | 0.632 | 340.1 Da LogP -3.60 TPSA 214.4 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@@H](O)[C@H](O)[C@@H…
|
| ZINC100351450 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@@H](O)[C@@H](OP(=O)…
|
| ZINC12503564 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@H](OP(=O)(O)O)[C@H]…
|
| ZINC12503566 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@H](OP(=O)(O)O)[C@@H…
|
| ZINC13508220 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](OP(=O…
|
| ZINC13541740 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@H](O)[C@@H](OP(=O)(…
|
| ZINC13557565 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](OP(=O…
|
| ZINC255995548 ZINC | 0.632 | 340.1 Da LogP -3.60 TPSA 214.4 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@H](O)[C@H](OP(=O)(O)O)[C@@H…
|
| ZINC255995550 ZINC | 0.632 | 340.1 Da LogP -3.60 TPSA 214.4 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@H](O)[C@H](O)[C@H](O)[C@@H](…
|
| ZINC25722866 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@@H](OP(=O)(O)O)[C@H](O)[C@@…
|
| ZINC26750262 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@H](O)[C@H](OP(=O)(O)O)[C@H]…
|
| ZINC26750593 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@H](OP(=O)(O)O)[C@@H](O)[C@@…
|
| ZINC26750597 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@H](OP(=O)(O)O)[C@@H](O)[C@H…
|
| ZINC26750602 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@@H](O)[C@@H](OP(=O)…
|
| ZINC27645762 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@@H](O)[C@@H](OP(=O)…
|
| ZINC27645853 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@@H](OP(=O)(O)O)[C@@H](O)[C@…
|
| ZINC27645862 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@@H](OP(=O)(O)O)[C@H](O)[C@H…
|
| ZINC34011720 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@H](O)[C@@H](OP(=O)(…
|
| ZINC34891245 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@@H](O)[C@H](OP(=O)(O)O)[C@H…
|
| ZINC36351454 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@H](O)[C@@H](O)[C@@H](OP(=O)…
|
| ZINC3869995 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@@H](O)[C@@H](OP(=O)…
|
| ZINC3869997 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@H](O)[C@@H](O)[C@@H](OP(=O)(…
|
| ZINC40690378 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@@H]1[C@H](O)[C@H](OP(=O)(O)O)[C@H]…
|
| ZINC4095596 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@@H](O)[C@@H](OP(=O)(O)O)[C@H…
|
| ZINC4095598 ZINC | 0.632 | 420.1 Da LogP -3.48 TPSA 261.0 | 1 viol. | ✓ Clean |
O=P(O)(O)O[C@H]1[C@H](O)[C@@H](OP(=O)(O)O)[C@H]…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.