KpATCC43816 Protein target profile

fructosamine deglycase frlB

Accession: VK055_2805

Gene: frlB AIK81394.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GHI7
Length 324
Pocket druggability (P2Rank · AlphaFold DB model) 0.943
Direct ligand evidence 0 58 total records
Functional annotation 0 EC 7 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
20.968 Lower values reduce human off-target concern.
Human E-value
3.14e-06
Gut microbiome similarity
0.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
27.004 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
97.26 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.943
Structure A0A0H3GHI7
Pocket Pocket 1
Druggability (FPocket) 0.969
Structure A0A0H3GHI7
Pocket Pocket 9
ColabFold model
P2Rank 0.902 · Pocket 1
FPocket 0.912 · Pocket 1
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 15 / 4744 genomes with a hit
Prevalence 0.3%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MNTKEIINAVAKEIEDKGGIRQVFLVACGGSLVDMYPAKYFLDSEATKLHVGMYTANEFVYATPKTLGENSLVIICSHGGNTPESVAAAKLAQQHQAHTITLTHNAQAQLIEYASHNILYAWGNDTNVVDNPMAIILNLCVDTLQQVEGFNNYADFQQGMTQINGVIAHGRQQVADRCQRFAQKYQDEKLFYILSSGASYGHAYGFAICSLMEMQWLHAAPIHSGEYFHGPFEVTNKETPFILLMNEGRTRAMDERALAFLTKYAEKVEVVDAKELGIGVLPPSVVEFFNPVLFYSIMCEYRSALADIRQHPLDTRRYMGLVEY

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

7 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

7
  • GO:0097367 Binding to a carbohydrate derivative.
  • GO:1901135 The chemical reactions and pathways involving carbohydrate derivative.
  • GO:0004360 Catalysis of the reaction: D-fructose 6-phosphate + L-glutamine = D-glucosamine 6-phosphate + L-glutamate.
  • GO:0016853 Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
  • GO:0006002 The chemical reactions and pathways involving fructose 6-phosphate, also known as F6P. The D-enantiomer is an important intermediate in glycolysis, gluconeogenesis, and fructose metabolism.
  • GO:0006487 A protein glycosylation process in which a carbohydrate or carbohydrate derivative unit is added to a protein via the N4 atom of an asparagine residue.
  • GO:0006047 The chemical reactions and pathways involving UDP-N-acetylglucosamine, a substance composed of N-acetylglucosamine, a common structural unit of oligosaccharides, in glycosidic linkage with uridine diphosphate.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
1 151 Gene3D G3DSA:3.40.50.10490 -
153 306 Gene3D G3DSA:1.10.10.2240 -
1 324 PIRSF PIRSF009290 FrlB
1 324 InterPro IPR024713 Fructosamine deglycase FrlB
5 322 SUPERFAMILY SSF53697 SIS domain
5 322 InterPro IPR046348 SIS domain superfamily
23 139 CDD cd05710 SIS_1
23 139 InterPro IPR035488 Fructosamine deglycase FrlB, SIS domain 1
7 317 PANTHER PTHR10937 GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE AMINOTRANSFERASE, ISOMERIZING
22 126 Pfam PF01380 SIS domain
22 126 InterPro IPR001347 SIS domain
189 282 Gene3D G3DSA:3.40.50.12570 -
176 318 CDD cd05009 SIS_GlmS_GlmD_2
176 318 InterPro IPR035490 GlmS/FrlB, SIS domain 2
10 150 ProSiteProfiles PS51464 SIS domain profile.
10 150 InterPro IPR001347 SIS domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.943
Likely same site as FPocket 9 4.6 Å 29 shared residues 78% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.12
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.1
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.017
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.011
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #9
0.969 Unusual size
Likely same site as P2Rank 1 4.6 Å 29 shared residues 78% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #3
0.616
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GHI7
AlphaFold DB full sequence Viewing
ColabFold VK055_2805
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 8 records from similar proteins
Structural ligands 7 0 loaded crystals
Measured bioactivity 1 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
AGP PDB via homolog 261.2 Da · LogP -3.50 · TPSA 173.7 Open detail RCSB PDB
F6R PDB via homolog Detail RCSB PDB
FLC PDB via homolog Detail RCSB PDB
G6Q PDB via homolog Detail RCSB PDB
HGA PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
AGP RCSB PDB P17169 261.2 Da LogP -3.50 TPSA 173.7 1 viol. ✓ Clean C([C@@H]([C@H]([C@@H]([C@@H](COP(=O)(O)O)O)O)O)…
F6R RCSB PDB P17169 260.1 Da LogP -3.26 TPSA 164.8 1 viol. ✓ Clean C([C@H]([C@H]([C@@H](C(=O)CO)O)O)O)OP(=O)(O)O
FLC RCSB PDB O32157 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
G6Q RCSB PDB P17169 260.1 Da LogP -3.26 TPSA 164.8 1 viol. ✓ Clean C([C@H]([C@H]([C@@H]([C@H](C=O)O)O)O)O)OP(=O)(O…
HGA RCSB PDB P17169 162.1 Da LogP -1.32 TPSA 112.7 ✓ Ro5 ✓ Clean C(CC(=O)NO)[C@@H](C(=O)O)N
UD1 RCSB PDB Q06210-2 607.4 Da LogP -4.65 TPSA 305.9 3 viol. ✓ Clean CC(=O)N[C@@H]1[C@H]([C@@H]([C@H](O[C@@H]1O[P@@]…
UD2 RCSB PDB Q06210-2 607.4 Da LogP -4.65 TPSA 305.9 3 viol. ✓ Clean CC(=O)N[C@@H]1[C@H]([C@H]([C@H](O[C@@H]1O[P@@](…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.