KpATCC43816 Protein target profile

cytochrome b

Accession: VK055_2833

Gene: cybC AIK81422.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GQS6
Length 128
Pocket druggability (P2Rank · AlphaFold DB model) 0.089
Direct ligand evidence 0 61 total records
Functional annotation 0 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
89.96 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.089
Structure A0A0H3GQS6
Pocket Pocket 1
Druggability (FPocket) 0.856
Structure A0A0H3GQS6
Pocket Pocket 1
ColabFold model
P2Rank 0.563 · Pocket 1
FPocket 0.601 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 83 / 4744 genomes with a hit
Prevalence 1.7%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MRKKLLAMLAVSAFALGSASAFADLGEDMDTLAENLQVVQKTSDAGELKAALNKMRTAAVDAQKETPPKLEGKAADSAEMKDYRHGLDILIGQIDGALKLANEGKVKEAQAAAEEFKTTRNTYHKKYR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
Periplasmic

Gene Ontology (GO)

5
  • GO:0005506 Binding to an iron (Fe) ion.
  • GO:0022900 A process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors.
  • GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring.
  • GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.
  • GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
1 128 PIRSF PIRSF000029 Cytochrome_b562
1 128 InterPro IPR009155 Cytochrome b562
1 23 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
45 65 Coils Coil Coil
23 128 SUPERFAMILY SSF47175 Cytochromes
23 128 InterPro IPR010980 Cytochrome c/b562
1 23 Phobius SIGNAL_PEPTIDE Signal peptide region
1 21 SignalP_EUK SignalP-noTM SignalP-noTM
18 128 Gene3D G3DSA:1.20.120.10 Cytochrome c/b562
5 16 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
24 128 Pfam PF07361 Cytochrome b562
24 128 InterPro IPR009155 Cytochrome b562
1 4 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
17 23 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 23 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
24 128 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.089
Likely same site as FPocket 1 1.2 Å 13 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.856
Likely same site as P2Rank 1 1.2 Å 13 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:124-124 axial binding residue
UniProt: Binding site:29-29 axial binding residue
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GQS6
AlphaFold DB full sequence Viewing
ColabFold VK055_2833
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

61 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 11 records from similar proteins
Structural ligands 11 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
CLR PDB via homolog 386.7 Da · LogP 7.39 · TPSA 20.2 Open detail RCSB PDB
FM9 PDB via homolog Detail RCSB PDB
HAE PDB via homolog Detail RCSB PDB
HQI PDB via homolog Detail RCSB PDB
KNW PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
CLR RCSB PDB P0ABE7 386.7 Da LogP 7.39 TPSA 20.2 1 viol. ✓ Clean CC(C)CCC[C@@H](C)[C@H]1CC[C@@H]2[C@@]1(CC[C@H]3…
FM9 RCSB PDB P0ABE7 371.4 Da LogP 3.84 TPSA 71.0 ✓ Ro5 ✓ Clean CC(C)Nc1cc(ncn1)c2csc(n2)N(C)C(=O)c3ccc(cc3)F
HAE RCSB PDB P0ABE7 75.1 Da LogP -0.49 TPSA 49.3 ✓ Ro5 ✓ Clean CC(=O)NO
HQI RCSB PDB P0ABE7 202.2 Da LogP 1.90 TPSA 62.2 ✓ Ro5 ✓ Clean CC(=O)Nc1ccc(c2c1cccn2)O
KNW RCSB PDB P0ABE7 585.0 Da LogP 5.65 TPSA 125.4 2 viol. ✓ Clean c1cc(c2c(c1)N(C[C@H](O2)C(=O)O)CCCC(=O)O)NC(=O)…
KO5 RCSB PDB P0ABE7 564.6 Da LogP 5.30 TPSA 125.4 2 viol. ✓ Clean Cc1ccc(cc1CCCCOc2ccc(cc2)C(=O)Nc3cccc4c3O[C@@H]…
OLA RCSB PDB P0ABE7 282.5 Da LogP 6.11 TPSA 37.3 1 viol. ✓ Clean CCCCCCCC\C=C/CCCCCCCC(=O)O
OLB RCSB PDB P0ABE7 356.5 Da LogP 4.92 TPSA 66.8 ✓ Ro5 ✓ Clean CCCCCCCC/C=C\CCCCCCCC(=O)OC[C@H](CO)O
OLC RCSB PDB P0ABE7 356.5 Da LogP 4.92 TPSA 66.8 ✓ Ro5 ✓ Clean CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](CO)O
PXX RCSB PDB P0ABE7 237.3 Da LogP 2.74 TPSA 54.9 ✓ Ro5 ✓ Clean CC(=O)Nc1cc2cccnc2c3c1cccn3
TLA RCSB PDB P0ABE7 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@@H]([C@H](C(=O)O)O)(C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.