KpATCC43816 Protein target profile
sugar (Glycoside-Pentoside-Hexuronide) transporter domain protein
Accession: VK055_2960
Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 27.389 Lower values reduce human off-target concern.
- Human E-value
- 1.04e-07
- Gut microbiome similarity
- 0.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 28.512 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 83.5 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSISMTTKLSYGFGAFGKDFAIGIVYMYLMYYYTDIVGLSVGVVGTLFLVARILDAIADPIMGWIVNCTRSRWGKFKPWILIGTITNSVVLYMLFSAHHFSGGALLAWVWLTYLLWGFTYTIMDVPFWSLVPTITLDKREREQLVPYPRFFASLAGFVTAGVTLPFVNAVGGADRGFGFQMFTLVLIAFFVVSTLVTLRNVHEVYSSDSGVSEDSSHLSLRQMVALIYKNDQLACLLGMALAYNTAANIIAGFAIYYFTYVIGSAEMFPYYMSYAGAANLLTLILFPRLVKGLSRRILWAGASIMPVLGCGVLLLMALGGVYNIALISLAGVLLNIGTALFWVLQVIMVADTVDYGEYTMNIRCESIAYSVQTLVVKAGSAFAAWFIAIVLGIIGYVPNVVQSSHTLLGMQAIMIALPTLFFALTLFLYFRYYKLNGDMLRRIQIHLLDKYRRVPENDVEPERPIVVPNQV
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Gene Ontology (GO)
5- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0015293 Enables the active transport of a solute across a membrane by a mechanism whereby two or more species are transported together in the same direction in a tightly coupled process not directly linked to a form of energy other than chemiosmotic energy.
- GO:0008643 The directed movement of carbohydrate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Carbohydrates are a group of organic compounds based of the general formula Cx(H2O)y.
- GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
- GO:0006814 The directed movement of sodium ions (Na+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 79 | 98 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 176 | 198 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 172 | 176 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 398 | 408 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 37 | 58 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 374 | 397 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 8 | 450 | NCBIfam | TIGR00792 | glycoside-pentoside-hexuronide (GPH):cation symporter |
| 8 | 450 | InterPro | IPR001927 | Sodium:galactoside symporter |
| 3 | 449 | PANTHER | PTHR11328 | MAJOR FACILITATOR SUPERFAMILY DOMAIN-CONTAINING PROTEIN |
| 3 | 449 | InterPro | IPR039672 | Lactose permease-like |
| 199 | 232 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 79 | 95 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 8 | 436 | CDD | cd17332 | MFS_MelB_like |
| 409 | 432 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 297 | 318 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 12 | 31 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 107 | 130 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 291 | 296 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 131 | 149 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 433 | 471 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 10 | 436 | Pfam | PF13347 | MFS/sugar transport protein |
| 8 | 428 | Gene3D | G3DSA:1.20.1250.20 | MFS general substrate transporter like domains |
| 8 | 428 | InterPro | IPR036259 | MFS transporter superfamily |
| 177 | 198 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 108 | 130 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 150 | 171 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 233 | 258 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 324 | 353 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 297 | 319 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 59 | 78 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 374 | 396 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 36 | 58 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 270 | 290 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 96 | 106 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 32 | 36 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 324 | 346 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 9 | 31 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 411 | 433 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 236 | 258 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 268 | 290 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 150 | 172 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 319 | 323 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 259 | 269 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 10 | 438 | SUPERFAMILY | SSF103473 | MFS general substrate transporter |
| 10 | 438 | InterPro | IPR036259 | MFS transporter superfamily |
| 59 | 84 | ProSitePatterns | PS00872 | Sodium:galactoside symporter family signature. |
| 59 | 84 | InterPro | IPR018043 | Sodium:galactoside symporter, conserved site |
| 1 | 11 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 354 | 373 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GM44
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_2960
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 9PG RCSB PDB | P30878 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1[N+](=O)[O-])O[C@@H]2[C@@H]([C@H]([C@H…
|
|
| LMO RCSB PDB | P30878 | 510.6 Da LogP -0.45 TPSA 178.5 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1070097 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@@H](CO)[C@@H](O)[…
|
| ZINC12359987 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@H](CO)[C@H](O)[C@…
|
| ZINC12359988 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@H]2O[C@H](CO)[C@H](O)[C@@…
|
| ZINC134307 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@H]2O[C@@H](CO)[C@H](O)[C@…
|
| ZINC134310 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@H]2O[C@@H](CO)[C@@H](O)[C…
|
| ZINC134325 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@@H](CO)[C@H](O)[C…
|
| ZINC156947 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@@H](CO)[C@@H](O)[…
|
| ZINC2539731 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@H]2O[C@@H](CO)[C@H](O)[C@…
|
| ZINC3956718 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@H](CO)[C@H](O)[C@…
|
| ZINC4028812 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@H](CO)[C@@H](O)[C…
|
| ZINC4282153 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@H]2O[C@H](CO)[C@@H](O)[C@…
|
| ZINC4282228 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@H]2O[C@H](CO)[C@@H](O)[C@…
|
| ZINC4282287 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@H]2O[C@H](CO)[C@H](O)[C@H…
|
| ZINC44963928 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@H]2O[C@H](CO)[C@H](O)[C@H…
|
| ZINC4521725 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@H]2O[C@@H](CO)[C@@H](O)[C…
|
| ZINC5227213 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@@H](CO)[C@@H](O)[…
|
| ZINC5227791 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@H]2O[C@H](CO)[C@H](O)[C@@…
|
| ZINC5842327 ZINC | 1.000 | 301.3 Da LogP -1.23 TPSA 142.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@H](CO)[C@@H](O)[C…
|
| ZINC13550855 ZINC | 0.973 | 271.2 Da LogP -0.59 TPSA 122.3 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@H](CO)[C@@H](O)[C…
|
| ZINC13550858 ZINC | 0.973 | 271.2 Da LogP -0.59 TPSA 122.3 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@H](CO)[C@H](O)[C@…
|
| ZINC144550115 ZINC | 0.973 | 271.2 Da LogP -0.59 TPSA 122.3 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@H]2O[C@@H](CO)[C@H](O)[C@…
|
| ZINC242464073 ZINC | 0.973 | 271.2 Da LogP -0.59 TPSA 122.3 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@H](CO)[C@H](O)[C@…
|
| ZINC2556632 ZINC | 0.973 | 271.2 Da LogP -0.59 TPSA 122.3 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@H](CO)[C@@H](O)[C…
|
| ZINC6093332 ZINC | 0.973 | 271.2 Da LogP -0.59 TPSA 122.3 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O[C@@H]2O[C@@H](CO)[C@H](O)[C…
|
| ZINC100034925 ZINC | 0.882 | 348.5 Da LogP 1.72 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O)[C@@H](…
|
| ZINC100056252 ZINC | 0.882 | 334.5 Da LogP 1.33 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[…
|
| ZINC100622862 ZINC | 0.882 | 348.5 Da LogP 1.72 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O)[C@@H](…
|
| ZINC100623036 ZINC | 0.882 | 334.5 Da LogP 1.33 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O)[C@@H](O…
|
| ZINC106384623 ZINC | 0.882 | 306.4 Da LogP 0.55 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@…
|
| ZINC118906375 ZINC | 0.882 | 264.3 Da LogP -0.62 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCO[C@H]1O[C@H](CO)[C@H](O)[C@@H](O)[C@@H]1O
|
| ZINC118911494 ZINC | 0.882 | 278.3 Da LogP -0.23 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCO[C@@H]1O[C@H](CO)[C@H](O)[C@@H](O)[C@@H…
|
| ZINC118911500 ZINC | 0.882 | 278.3 Da LogP -0.23 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCO[C@H]1O[C@H](CO)[C@H](O)[C@@H](O)[C@@H]…
|
| ZINC118911909 ZINC | 0.882 | 306.4 Da LogP 0.55 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCO[C@H]1O[C@H](CO)[C@H](O)[C@@H](O)[C@@…
|
| ZINC140958235 ZINC | 0.882 | 348.5 Da LogP 1.72 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCO[C@@H]1O[C@H](CO)[C@H](O)[C@@H](O)…
|
| ZINC141261234 ZINC | 0.882 | 320.4 Da LogP 0.94 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@H](O)[C@@H](O)[C…
|
| ZINC141262250 ZINC | 0.882 | 320.4 Da LogP 0.94 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCO[C@H]1O[C@H](CO)[C@H](O)[C@@H](O)[C@…
|
| ZINC14880350 ZINC | 0.882 | 306.4 Da LogP 0.55 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCO[C@H]1O[C@@H](CO)[C@@H](O)[C@@H](O)[C…
|
| ZINC15609263 ZINC | 0.882 | 306.4 Da LogP 0.55 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@…
|
| ZINC48016017 ZINC | 0.882 | 278.3 Da LogP -0.23 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]…
|
| ZINC58538417 ZINC | 0.882 | 320.4 Da LogP 0.94 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C…
|
| ZINC71788565 ZINC | 0.882 | 306.4 Da LogP 0.55 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O)[C@H](O)[C…
|
| ZINC71788566 ZINC | 0.882 | 306.4 Da LogP 0.55 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O)[C@H](O)[C…
|
| ZINC76945547 ZINC | 0.882 | 292.4 Da LogP 0.16 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCO[C@@H]1O[C@H](CO)[C@H](O)[C@@H](O)[C@@…
|
| ZINC85478989 ZINC | 0.882 | 320.4 Da LogP 0.94 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCO[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@…
|
| ZINC85590876 ZINC | 0.882 | 320.4 Da LogP 0.94 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O)[C@@H](O)…
|
| ZINC85590883 ZINC | 0.882 | 320.4 Da LogP 0.94 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCO[C@H]1O[C@@H](CO)[C@@H](O)[C@@H](O)[…
|
| ZINC85590888 ZINC | 0.882 | 320.4 Da LogP 0.94 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O)[C@@H](O)…
|
| ZINC85605815 ZINC | 0.882 | 348.5 Da LogP 1.72 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCO[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[…
|
| ZINC94437834 ZINC | 0.882 | 292.4 Da LogP 0.16 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCO[C@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O
|
| ZINC95713698 ZINC | 0.882 | 348.5 Da LogP 1.72 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.