KpATCC43816 Protein target profile

transcriptional regulatory, C terminal family protein

Accession: VK055_2984

Gene: AIK81569.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GHQ7
Length 242
Pocket druggability (P2Rank · AlphaFold DB model) 0.059
Direct ligand evidence 0 10 total records
Functional annotation 0 EC 7 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
40.104 Higher values support similarity to known essential genes.
DEG E-value
7.97e-41 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
86.1 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.059
Structure A0A0H3GHQ7
Pocket Pocket 1
Druggability (FPocket) 0.527
Structure A0A0H3GHQ7
Pocket Pocket 14
ColabFold model
P2Rank 0.009 · Pocket 1
FPocket 0.564 · Pocket 5
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 50 / 4744 genomes with a hit
Prevalence 1.1%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MKPVILVVDDDIAMGELLSDVLGAHAFEVLVCQTGGDALAMVAQRADIALVLLDMILPDTHGLQVLQQLQRTRPELPVVMLSGLGSESDVVVGLEMGADDYIAKPFSSRVVVARVKAVLRRSGALAGEASGVGSGLTFNGWRLDTTRCELYNPQQQAVPLTQGEYGLLLALAQNARRVLNREQLLALTHNESTEVFDRTIDVLIMRLRRKIELNPHQPTLIKTLRGLGYVFSADVTHSEKAA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

7 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

7
  • GO:0000160 A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0032993 A macromolecular complex containing both protein and DNA molecules.
  • GO:0000156 Responds to a phosphorelay sensor to initiate a change in cell state or activity. The activity of the response regulator is regulated by transfer of a phosphate from a histidine residue in the sensor, to an aspartate residue in the response regulator. Many but not all response regulators act as transcriptional regulators to elicit a response.
  • GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

26 records
Show feature table
Start End DB Term Name
4 88 Gene3D G3DSA:3.40.50.2300 -
126 234 FunFam G3DSA:1.10.10.10:FF:000099 Two-component system response regulator TorR
4 119 ProSiteProfiles PS50110 Response regulatory domain profile.
4 119 InterPro IPR001789 Signal transduction response regulator, receiver domain
133 237 Gene3D G3DSA:1.10.10.10 -
133 237 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
3 115 SMART SM00448 REC_2
3 115 InterPro IPR001789 Signal transduction response regulator, receiver domain
89 121 Gene3D G3DSA:6.10.250.690 -
136 234 SUPERFAMILY SSF46894 C-terminal effector domain of the bipartite response regulators
136 234 InterPro IPR016032 Signal transduction response regulator, C-terminal effector
6 105 CDD cd17574 REC_OmpR
156 231 Pfam PF00486 Transcriptional regulatory protein, C terminal
156 231 InterPro IPR001867 OmpR/PhoB-type DNA-binding domain
2 125 SUPERFAMILY SSF52172 CheY-like
2 125 InterPro IPR011006 CheY-like superfamily
2 234 PANTHER PTHR48111 REGULATOR OF RPOS
2 234 InterPro IPR039420 Transcriptional regulatory protein WalR-like
5 115 Pfam PF00072 Response regulator receiver domain
5 115 InterPro IPR001789 Signal transduction response regulator, receiver domain
155 231 SMART SM00862 Trans_reg_C_3
155 231 InterPro IPR001867 OmpR/PhoB-type DNA-binding domain
141 231 CDD cd00383 trans_reg_C
141 231 InterPro IPR001867 OmpR/PhoB-type DNA-binding domain
133 233 ProSiteProfiles PS51755 OmpR/PhoB-type DNA-binding domain profile.
133 233 InterPro IPR001867 OmpR/PhoB-type DNA-binding domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.059
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #14
0.527
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GHQ7
AlphaFold DB full sequence Viewing
ColabFold VK055_2984
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

10 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 4 records from similar proteins
Structural ligands 4 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 6 similarity-based ZINC candidates
Best available ligand signal
BEF PDB via homolog 66.0 Da · LogP 0.88 · TPSA 0.0 Open detail RCSB PDB
BF2 PDB via homolog Detail RCSB PDB
BTB PDB via homolog Detail RCSB PDB
PHS PDB via homolog Detail RCSB PDB
ZINC1615342 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
BEF RCSB PDB A0A0H2UQ68 66.0 Da LogP 0.88 TPSA 0.0 ✓ Ro5 ✓ Clean [Be-](F)(F)F
BF2 RCSB PDB P0A9Q1 47.0 Da LogP 0.46 TPSA 0.0 ✓ Ro5 ✓ Clean [Be](F)F
BTB RCSB PDB P0AA16 209.2 Da LogP -3.01 TPSA 104.4 ✓ Ro5 ✓ Clean C(CO)N(CCO)C(CO)(CO)CO
PHS RCSB PDB A0A0H2UQ68 82.0 Da LogP -0.64 TPSA 57.5 ✓ Ro5 ✓ Clean OP(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.